DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and SYP43

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_850519.1 Gene:SYP43 / 819740 AraportID:AT3G05710 Length:331 Species:Arabidopsis thaliana


Alignment Length:228 Identity:52/228 - (22%)
Similarity:90/228 - (39%) Gaps:73/228 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTRDEKLPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQIK 65
            :|::....||::|..:||. ..|.|...|   |.|.|:::|||                  ..::
plant   133 LTQEVTFLLKKSEKQLQRL-SAAGPSEDS---NVRKNVQRSLA------------------TDLQ 175

  Fly    66 NLLLEMDALREKVREEDLERFDDLMKPGRDTAFAGMKEFAELQLKSPTSTLSSQY---DDDLDNQ 127
            ||.:|   ||:| :...|:|.....:.|.|         .|:.|.      .|:|   |||.|  
plant   176 NLSME---LRKK-QSTYLKRLRLQKEDGAD---------LEMNLN------GSRYKAEDDDFD-- 219

  Fly   128 PQEVDMNSLPAHRHMPQLQLNFQLEEHQLAQ----RQACLDQMENLQQEIYDLHGMFQGMRQLTA 188
                ||                ...|||:::    .:..:::.:.:||.:..:..:.|.|:.|:|
plant   220 ----DM----------------VFSEHQMSKIKKSEEISIEREKEIQQVVESVSELAQIMKDLSA 264

  Fly   189 ---EQSVAVEKIADNAEEALENVQQGELNLRRA 218
               :|...|::|..|.:.....|..|...|::|
plant   265 LVIDQGTIVDRIDYNIQNVASTVDDGLKQLQKA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 13/67 (19%)
SYP43NP_850519.1 COG5325 81..327 CDD:227635 52/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.