DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and Stx7

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_068641.2 Gene:Stx7 / 60466 RGDID:619747 Length:261 Species:Rattus norvegicus


Alignment Length:180 Identity:42/180 - (23%)
Similarity:78/180 - (43%) Gaps:37/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QKIKKEELNAMRVIKQIKNLLLEMDALREKVREEDLERFDDLMKPGRDTAFAGMKEFAELQLKSP 112
            :||:|:     |::.:....|...    :||:.:..||               .|||......| 
  Rat    86 RKIQKD-----RLVAEFTTALTNF----QKVQRQAAER---------------EKEFVARVRAS- 125

  Fly   113 TSTLSSQYDDDLDNQPQEVDMNSLPAHRHMPQLQL-NFQLEEHQLA---QRQACLDQMENLQQEI 173
             |.:|..:.:|...:...|...|    :..||:|: :.::.|..|.   :|::.:.|:|   .:|
  Rat   126 -SRVSGGFPEDSSKEKNFVSWES----QTQPQVQVQDEEITEDDLRLIHERESSIRQLE---ADI 182

  Fly   174 YDLHGMFQGMRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK 223
            .|::.:|:.:..:..||...::.|..|.|.|..:|||....|.||..|::
  Rat   183 MDINEIFKDLGMMIHEQGDVIDSIEANVESAEVHVQQANQQLSRAANYQR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 17/63 (27%)
Stx7NP_068641.2 Syntaxin_2 18..119 CDD:405246 11/56 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..148 4/23 (17%)
SNARE_syntaxin7 168..227 CDD:277228 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.