DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and stx12l

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_697581.4 Gene:stx12l / 569124 ZFINID:ZDB-GENE-110715-1 Length:267 Species:Danio rerio


Alignment Length:107 Identity:23/107 - (21%)
Similarity:45/107 - (42%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DDLDNQPQEVDMNSLPAHRHMPQLQLNFQLEEHQLAQRQACL-----DQMENLQQEIYDLHGMFQ 181
            |:|:...|.|........|        .|.||..:.:....|     ..:..|:.:|.|::.:|:
Zfish   140 DELNQDEQLVTFEKNEGWR--------MQTEEEPVTEEDLELIKERETNIRQLESDIMDVNQIFK 196

  Fly   182 GMRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK 223
            .:..:..:|...::.|..|.|.|..:|::|...|:.|..|::
Zfish   197 DLAVMIHDQGDMIDSIEANVESAEVHVERGAEQLQHAAYYQR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 13/65 (20%)
stx12lXP_697581.4 Syntaxin_2 26..128 CDD:291208
Syntaxin 29..206 CDD:279182 13/73 (18%)
SNARE_syntaxin12 174..240 CDD:277229 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.