DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and stx7l

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_003200808.1 Gene:stx7l / 562669 ZFINID:ZDB-GENE-041014-35 Length:258 Species:Danio rerio


Alignment Length:255 Identity:52/255 - (20%)
Similarity:110/255 - (43%) Gaps:47/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAM-----RVIKQIKNLLLEMDAL 74
            :|||.  ..:.:.:..|..|....:.:..|....:.|::.:|.:     :.:|...:|....:..
Zfish    19 NIQRI--TLLTNEIQQLMRHLGTAQDTSDLRQTLQEKQQSVNQLAKVTDKCMKDFSSLPATTEQR 81

  Fly    75 REKV-REEDLERFDDLM----KPGRDTAFAGMKEF-AELQLKSPTSTLSSQYDDDLDNQPQEVDM 133
            :.|: ||..:..|.:::    |..|:.| ...||| |.::..|..|      ..|:|    :|..
Zfish    82 QRKIQRERLITEFSNVLAVFQKAQREVA-KKEKEFVARVRASSRVS------GGDID----DVFG 135

  Fly   134 NSLPAHRHMPQLQLNFQLEEHQ----------LAQRQACLDQMENLQQEIYDLHGMFQGMRQLTA 188
            .:.||.    |.:.:.|.:.::          :.:|::.:.|:|:   :|.|::.:|:.:..:..
Zfish   136 RAAPAF----QSEFSAQAQSYEENITEEDLRLIQERESSIRQLES---DITDINEIFRDLGMMVH 193

  Fly   189 EQSVAVEKIADNAEEALENVQQGELNLRRA----LTYKKAMYPVVGALLGTCVGGPIGLV 244
            ||...::.|..|...|..:||.....|:||    .:::|.::.:|..|....:  .|||:
Zfish   194 EQGDMIDSIEANVSNAEISVQSATEQLQRAAGHQTSFRKKIFILVAVLAVAAL--IIGLI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 14/60 (23%)
stx7lXP_003200808.1 Syntaxin_2 16..116 CDD:316990 19/99 (19%)
SNARE_syntaxin7 164..223 CDD:277228 14/61 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.