DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and STX17

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_060389.2 Gene:STX17 / 55014 HGNCID:11432 Length:302 Species:Homo sapiens


Alignment Length:281 Identity:95/281 - (33%)
Similarity:151/281 - (53%) Gaps:12/281 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEKLPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLL 68
            :||:.|::.|.:||:|..:.:|..|..|:.|:.||||......|.|:.:|.:||.|.::|:::.:
Human     5 EEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNI 69

  Fly    69 LEMDALREKVREEDLERFDDLMKPGRDTAFAGMKEFAELQLKSPTSTLSSQYDDD--LDNQPQEV 131
            .|::.|..|||::||.....::.|.::.|.|...||.:|.|:| ...|..|::|:  |...|...
Human    70 REIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLES-VEELKKQFNDEETLLQPPLTR 133

  Fly   132 DM------NSLPAHRHMPQLQLNFQLEEHQLAQRQACLDQMENLQQEIYDLHGMFQGMRQLTAEQ 190
            .|      ::..|......|...:.|.|  :.|.|...:..|.|:.::.:|..:......|...|
Human   134 SMTVGGAFHTTEAEASSQSLTQIYALPE--IPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQ 196

  Fly   191 SVAVEKIADNAEEALENVQQGELNLRRALTYKKAMYPVVGALLGTCVGGPIGLVAGMKAGGL-AA 254
            ...::.|||:...|..||::|..||.:|..||.|..||.|||:|..|||||||:||.|..|: ||
Human   197 QEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIGGMVGGPIGLLAGFKVAGIAAA 261

  Fly   255 VGCGILGFTGGSVLKANPNVM 275
            :|.|:||||||.:::.....|
Human   262 LGGGVLGFTGGKLIQRKKQKM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 16/60 (27%)
STX17NP_060389.2 COG5325 2..228 CDD:227635 64/225 (28%)
SNARE_syntaxin17 162..223 CDD:277199 16/60 (27%)
Necessary and sufficient for localization to autophagosome. /evidence=ECO:0000269|PubMed:23217709 229..275 28/45 (62%)
Endoplasmic reticulum retention signal. /evidence=ECO:0000255 299..302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146156
Domainoid 1 1.000 152 1.000 Domainoid score I4316
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9917
Inparanoid 1 1.050 153 1.000 Inparanoid score I4354
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49838
OrthoDB 1 1.010 - - D1493840at2759
OrthoFinder 1 1.000 - - FOG0008362
OrthoInspector 1 1.000 - - oto89134
orthoMCL 1 0.900 - - OOG6_108277
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5748
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.700

Return to query results.
Submit another query.