DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and Stx7

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001345492.1 Gene:Stx7 / 53331 MGIID:1858210 Length:261 Species:Mus musculus


Alignment Length:266 Identity:54/266 - (20%)
Similarity:109/266 - (40%) Gaps:56/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKQAEVSIQR-FQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLLLEMD 72
            :.|..|.||| ...:..|.....|:               |::::::....::.|:....:.|..
Mouse    25 ITQCSVEIQRTLNQLGTPQDSPELR---------------QQLQQKQQYTNQLAKETDKYIKEFG 74

  Fly    73 AL--------REKVREEDL-----ERFDDLMKPGRDTAFAGMKEFAELQLKSPTSTLSSQYDDDL 124
            :|        :.|::::.|     ....:..|..|..| ...|||......|  |.:|..:.:|.
Mouse    75 SLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKAQRQAA-EREKEFVARVRAS--SRVSGGFPEDS 136

  Fly   125 DNQPQEVDMNSLPAHRHMPQLQL-NFQLEEHQLA---QRQACLDQMENLQQEIYDLHGMFQGMRQ 185
            ..:...|...|    :..||:|: :.::.|..|.   :|::.:.|:|   .:|.|::.:|:.:..
Mouse   137 SKEKNLVSWES----QTQPQVQVQDEEITEDDLRLIHERESSIRQLE---ADIMDINEIFKDLGM 194

  Fly   186 LTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK--------AMYPVVGALLGTCVGGPIG 242
            :..||...::.|..|.|.|..:|||....|.||..|::        .::.:|..::..|:     
Mouse   195 MIHEQGDMIDSIEANVESAEVHVQQANQQLSRAADYQRKSRKTLCIIIFILVVGIVIICL----- 254

  Fly   243 LVAGMK 248
            :|.|:|
Mouse   255 IVWGLK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 17/63 (27%)
Stx7NP_001345492.1 SynN 13..150 CDD:238105 25/146 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..148 4/23 (17%)
SNARE_syntaxin7 168..227 CDD:277228 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.