DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and stx17

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_005158110.1 Gene:stx17 / 492808 ZFINID:ZDB-GENE-041114-164 Length:292 Species:Danio rerio


Alignment Length:284 Identity:87/284 - (30%)
Similarity:142/284 - (50%) Gaps:32/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTRDE--KLPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQ 63
            |..||  ||||::.|..||:|..||:|..|..|..|:.||||......|.|:..|.:|:.|.::|
Zfish     1 MMADEAGKLPLRRLEPPIQKFIKVAIPTDLERLHQHQHNIEKFQRNRQWDKLHHEHINSSRTVQQ 65

  Fly    64 IKNLLLEMDALREKVREEDLERFDDLMKPGRDTAFAGMKEFAELQ------------LKSPTSTL 116
            :::.|.||:.|..:||..|.|..:.|::|.||.|.|.::||.::.            :.:...|.
Zfish    66 LRSNLREMEKLCGRVRSVDAEALEKLVQPIRDRASAAIQEFLQIHSDAVNRQNFNEAIATVAETS 130

  Fly   117 SSQYDDDLDNQPQEVDMNSLPAHRHMPQLQLNFQLEEHQLAQRQACLDQMENLQQEIYDLHGMFQ 181
            .|:.|..:...|.......||                 ::...|...:..::|.:::..|:|:..
Zfish   131 HSEDDTGVSGSPVTQTQLLLP-----------------EIPSEQNAAESWDSLAEDLLQLNGLVN 178

  Fly   182 GMRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKKAMYPVVGALLGTCVGGPIGLVAG 246
            ....:...|...::.|..|...|..||::|..:|.:|...|.|:.||.||::|..:|||:||:||
Zfish   179 EFSTIVHAQQEKIDSIEANVSIAAANVEEGTQSLGKAARAKLAVLPVAGAVVGGVLGGPLGLLAG 243

  Fly   247 MKAGGLAAV-GCGILGFTGGSVLK 269
            .|..|:||. |.|:|||.||::::
Zfish   244 FKVAGVAAAFGGGLLGFAGGNLIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 12/60 (20%)
stx17XP_005158110.1 SNARE_syntaxin17 153..214 CDD:277199 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579721
Domainoid 1 1.000 138 1.000 Domainoid score I4840
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9917
Inparanoid 1 1.050 138 1.000 Inparanoid score I4517
OMA 1 1.010 - - QHG49838
OrthoDB 1 1.010 - - D1493840at2759
OrthoFinder 1 1.000 - - FOG0008362
OrthoInspector 1 1.000 - - oto40693
orthoMCL 1 0.900 - - OOG6_108277
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5748
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.700

Return to query results.
Submit another query.