DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and Stx16

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_006235755.1 Gene:Stx16 / 362283 RGDID:1309423 Length:326 Species:Rattus norvegicus


Alignment Length:188 Identity:46/188 - (24%)
Similarity:72/188 - (38%) Gaps:57/188 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KKEELNAMRVIKQIKNLLLEM---------DAL-REKVREEDLERFDD----LMKPGRDTAFAGM 101
            ::||.....|:..:...|.|:         |.| |.|.|||..:.|.|    ||..|.|      
  Rat   153 EQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDD------ 211

  Fly   102 KEFAELQLKSPTSTLSSQ-YDDDLDNQPQEVDMNSLPAHRHMPQLQLNFQLEEHQLAQRQACLDQ 165
                        :||..| :.||   |...|:.|:|             .:||.:...||     
  Rat   212 ------------ATLYGQGFTDD---QLVLVEQNTL-------------VVEEREREIRQ----- 243

  Fly   166 MENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK 223
               :.|.|.||:.:|:.:..:..||...:::|..|.|::....:.|...|.:|..|:|
  Rat   244 ---IVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCVKTEDGLKQLHKAEQYQK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 14/60 (23%)
Stx16XP_006235755.1 SynN 80..>194 CDD:294095 11/40 (28%)
SNARE_syntaxin16 234..292 CDD:277198 16/65 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.