DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and Syx7

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster


Alignment Length:265 Identity:60/265 - (22%)
Similarity:103/265 - (38%) Gaps:62/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AEVSIQRFQDVAVPHHLSLLKNHRSNIEKSL----ALGDWQKIKKEELNAMRVIKQI----KNLL 68
            :|:..||...: :...:..::.:.|.:::.:    ...|..::||:....|....|:    .|.:
  Fly    19 SEIDFQRLAQI-IATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQI 82

  Fly    69 LEMDALREKVREEDLERFDDLMKPGRDTAFAGMKEFAELQLKS---------------------P 112
            .|:|..:|  |...::| |.|:    |...|.:..|..:|.|:                     |
  Fly    83 NEVDKCKE--RHLKIQR-DRLV----DEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPP 140

  Fly   113 TSTLSSQYDDDLDNQPQEVDMNSLPA----HRHMPQLQLNFQLEEHQLAQRQACLDQMENLQQEI 173
            .|:.:...:.....|    |.||...    :|...|.|:..|:||      ||.|..:|..:|.|
  Fly   141 GSSRTGSSNSSASQQ----DNNSFFEDNFFNRKSNQQQMQTQMEE------QADLQALEEQEQVI 195

  Fly   174 YDLHGMFQGMRQ-------LTAEQSVAVEKIADNAEEALENVQQGELNLRRALTY----KKAMYP 227
            .:|.....|:.:       |..||.:.|:.|....|:....|.||..|||:|.:|    :|....
  Fly   196 RELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLI 260

  Fly   228 VVGAL 232
            :||.|
  Fly   261 LVGIL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 19/67 (28%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 19/102 (19%)
COG5325 <97..276 CDD:227635 46/184 (25%)
SNARE 188..247 CDD:304603 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467319
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.