DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and Syx16

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_523420.1 Gene:Syx16 / 33034 FlyBaseID:FBgn0031106 Length:352 Species:Drosophila melanogaster


Alignment Length:252 Identity:57/252 - (22%)
Similarity:104/252 - (41%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RDEKLPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEE---LNAMR-VIKQ 63
            ||::..:   ||..|....:....|     .|...:..|:.:|.    |.|:   :||:. .:.|
  Fly    97 RDDECDI---EVLSQIVSKLITSTH-----RHIQCVRSSIGVGS----KMEQCLTVNAVHCALLQ 149

  Fly    64 IKNLLLEMDA------LREKVREEDLERFDDLMKPGRDTAFAGMKE-FAELQLKSPTSTLSSQYD 121
            ::.|.::..|      |:...|||..:::.|      |...||..: |..::|...:   :..:.
  Fly   150 LQELTVKFRASQNAYLLQLNSREERSQKYFD------DGGGAGAGDVFTNVELGEQS---AENFV 205

  Fly   122 DDLDN--QP----------------QEVD--MNSLPAHRHMPQLQLNFQLEEHQLAQRQACLDQM 166
            |..||  ||                |.:|  ....||.|...|..|.|:.|..::||.:.  .::
  Fly   206 DSFDNFLQPPAEGKSGNGYLFEDDEQAIDDHFQRPPASRMTQQQLLLFEEENTRVAQHRE--QEV 268

  Fly   167 ENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK 223
            ..:.:.||||:.:|:.:..:..||...:::|..|.|:....|.:|...|.:|..|::
  Fly   269 TKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 15/60 (25%)
Syx16NP_523420.1 SNARE_syntaxin16 261..319 CDD:277198 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.