DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and tlg2

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_593832.1 Gene:tlg2 / 2543436 PomBaseID:SPAC823.05c Length:301 Species:Schizosaccharomyces pombe


Alignment Length:228 Identity:49/228 - (21%)
Similarity:88/228 - (38%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SLLKNHRSNI---EKSLA------LGDWQKIKKEELNAMRVIKQIKNLLLEMDALREKVREEDLE 84
            |||.|.|.||   :|..|      ..|    |.|:.|      :|:.|.:::        .:|.:
pombe    67 SLLLNTRRNINLLDKQYAKHVLPSFSD----KTEQEN------EIQRLTIQI--------TQDFQ 113

  Fly    85 RFDDLMK---------PGRDTAFAGMKEFAELQLKSPTSTLSSQYDDDLDNQPQE---VDMNSLP 137
            |...|::         .|.:...|  |.|.. .|.|...|.|:|:........::   ::.|..|
pombe   114 RCQKLLQVTKAQTNSATGSEALMA--KNFLS-NLASRIQTESAQFRKKQSTYLKKLRGLNANISP 175

  Fly   138 AHRHMPQLQLNFQLEEHQLAQRQACLDQMENLQ------------QEIYDLHGMFQGMRQLTAEQ 190
            ....:.:...:..:.:..:.|.....:|.|:.|            :.|.:|..|||.::.|..||
pombe   176 VESKLDETVSDVAISQSTIQQVALMEEQGEDEQAIRHERAVAKIAEGIIELAQMFQDLQVLVIEQ 240

  Fly   191 SVAVEKIADNAEEALENVQQGELNLRRALTYKK 223
            ...|::|..|.|:...:.:..|..|.:|.:::|
pombe   241 GALVDRIDFNIEQTQVHAKSAEKELIKAESHQK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 18/72 (25%)
tlg2NP_593832.1 COG5325 24..301 CDD:227635 49/228 (21%)
SNARE_syntaxin16 209..267 CDD:277198 14/57 (25%)
SNARE 243..293 CDD:283412 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.