DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and pep12

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_595100.2 Gene:pep12 / 2540289 PomBaseID:SPBC31E1.04 Length:263 Species:Schizosaccharomyces pombe


Alignment Length:268 Identity:57/268 - (21%)
Similarity:108/268 - (40%) Gaps:69/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LKNHRSNIEKSLALGDWQKIKK---EELNAMR-------------VIKQIKNLLLEMDALREKVR 79
            |:..|..||::   ||:..:..   :|::|:|             :.|.:..:|.:...|.:|||
pombe     6 LEQGRHKIEQN---GDFPALASSIAQEIHALRGNTAAIHRYLVNNLTKNLHEVLEQSRELSQKVR 67

  Fly    80 EEDLERFDDL--MKPGRD-TAFAGMK---EF----AELQLKSPTSTLSSQYDDD----------- 123
             .||.|..::  .|.|.: ::||..|   :|    ||||   ......:|.:.|           
pombe    68 -SDLVRLANIKDTKYGEEASSFALSKLTRDFNTVLAELQ---RVQQKCAQQESDSVAAAQAALNQ 128

  Fly   124 ------LDNQPQEVDMNSLPAHRHMPQLQ---LNFQLEEHQ--LAQRQACLDQMENLQQEIYDLH 177
                  ::.:.:.|.:::..:.:..|..:   .|.|||..|  :.:||.   ::|||.|.|.:|:
pombe   129 DVGQHFIEEEERNVSLSNNSSGQRQPLTESKISNSQLEYQQRLINERQG---EIENLTQGINELN 190

  Fly   178 GMFQGMRQLTAEQSVAVEKIADNAEEALENVQQGELNL-----------RRALTYKKAMYPVVGA 231
            .:|:.:..:..||...|..|..|......|.:.....|           :|:..:...:..::|.
pombe   191 EIFRDLSTIINEQGELVTNIEYNVGNTSTNTKNASRQLQIANEHSRKARKRSFCFLVILVVILGV 255

  Fly   232 LLGTCVGG 239
            :|...:.|
pombe   256 ILTALIMG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 16/71 (23%)
pep12NP_595100.2 COG5325 1..261 CDD:227635 56/264 (21%)
SynN 14..116 CDD:294095 26/108 (24%)
SNARE_Qa 172..229 CDD:277193 15/59 (25%)
SNARE 205..256 CDD:283412 7/50 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.