DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and STX12

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_803173.1 Gene:STX12 / 23673 HGNCID:11430 Length:276 Species:Homo sapiens


Alignment Length:217 Identity:43/217 - (19%)
Similarity:90/217 - (41%) Gaps:60/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLLLEM 71
            |||..:|...||.|...:.:..|...|:...:::.::     :.:||.:...|...::       
Human    89 LPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVS-----EKEKESIARARAGSRL------- 141

  Fly    72 DALREKVREEDLERFDDLMKPGRDTAFAGMKEFAELQLKSPTSTLSSQYDDDLDNQPQEVDMNSL 136
             :..|:.|||.|..||            ..:|:.::|         || :|::....|::::   
Human   142 -SAEERQREEQLVSFD------------SHEEWNQMQ---------SQ-EDEVAITEQDLEL--- 180

  Fly   137 PAHRHMPQLQLNFQLEEHQLAQRQACLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADNA 201
                          ::|.:.|.||        |:.:|.|::.:|:.:..:..:|...::.|..|.
Human   181 --------------IKERETAIRQ--------LEADILDVNQIFKDLAMMIHDQGDLIDSIEANV 223

  Fly   202 EEALENVQQGELNLRRALTYKK 223
            |.:..:|::....|:||..|:|
Human   224 ESSEVHVERATEQLQRAAYYQK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 13/60 (22%)
STX12NP_803173.1 Syntaxin_2 30..132 CDD:373109 11/47 (23%)
SNARE_syntaxin12 181..247 CDD:277229 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.