DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and TSNARE1

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_011515216.1 Gene:TSNARE1 / 203062 HGNCID:26437 Length:838 Species:Homo sapiens


Alignment Length:371 Identity:65/371 - (17%)
Similarity:112/371 - (30%) Gaps:145/371 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TRDEKLPLKQAEVSIQRFQDVAVPHHLSLL---------KNHRSNIEKSLALGDWQKIKKEELNA 57
            ||......::.||.:||     |..|..||         :.||.          |.:| .:.:||
Human   525 TRKPNFSPQETEVLVQR-----VRRHYPLLFGALRGTPARKHRV----------WSRI-LQAVNA 573

  Fly    58 M----RVIKQIKNLLLEM-DALREKVRE------------------------------------- 80
            :    |.:..:|:...:: .|:|:|:.|                                     
Human   574 LGYCRRDLGDLKHKWRDLRGAVRKKLAEGGPAPGLLLTPVERMVAETFSAHGPQGEGQTTEPLPT 638

  Fly    81 -EDLERFDDLMKPGRDTAFAGMKEFAELQLKS-------------------PTSTLSSQYDDDLD 125
             |:.|....|..|.|......:.|...|.|:.                   |.:||...:.   .
Human   639 DEEDETPSCLWLPLRSLEGPSLPEPDPLDLRGVFHAPTSSPSPPASPASTPPATTLMGAFQ---P 700

  Fly   126 NQPQEVDMNSLPAHRHMPQLQLNFQLEEHQLAQRQACLDQMENLQQEIYDLH--------GMFQG 182
            :.|.......||:.|                  ..|...:....:|::.|.|        ...|.
Human   701 SPPSSAPAPPLPSRR------------------TPAAASETSAFEQQLLDSHRQQGALLSSWAQQ 747

  Fly   183 MRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKKAMYPVVGALLGTCVGGPIGLVAGM 247
            ...|.|:|::.::::|:.::...:.|:.....|.|.:..:.           |....| .|..|.
Human   748 QSTLMAQQNLLLQRLAEQSQRLADGVEALNRTLERLVEARP-----------TREASP-SLQDGS 800

  Fly   248 KAGGLAAVGCGILGFTGGSVLKANPNVMHGNIE---------EEQV 284
            .|.|:|.      |..|||  :.:|...|..:|         ||::
Human   801 PASGVAQ------GPAGGS--QDSPKGTHSGLEVFSGMILKVEEEI 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 11/68 (16%)
TSNARE1XP_011515216.1 Myb_DNA-bind_5 151..225 CDD:290584
Syntaxin_2 292..393 CDD:291208
SNARE 444..>484 CDD:304603
Myb_DNA-bind_5 526..598 CDD:290584 19/87 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.