DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and syx-2

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_510323.3 Gene:syx-2 / 181505 WormBaseID:WBGene00006372 Length:299 Species:Caenorhabditis elegans


Alignment Length:225 Identity:52/225 - (23%)
Similarity:99/225 - (44%) Gaps:20/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EKLPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQK-IKKEELNAMRVIKQIKNLL 68
            |||...|..|......|   |...::|:|....|.:  ..||.:| :::.|.:.:...||:::: 
 Worm    52 EKLRRDQQHVLALTIAD---PRDKNILENQIGTIRR--RTGDLRKLVRQAEDDFLEFTKQVQSV- 110

  Fly    69 LEMDALREKVREEDLERFDD----LMKPGRDTAFAGMKEFAELQLKSPTSTLSSQYDDDLDNQPQ 129
                 ..:::|:..||...|    |:....:| ....|....::::....|:.....|:..|:..
 Worm   111 -----TEKRMRQNQLELLKDNLNKLINLFNET-HQDYKSRVSVRVRRQLQTVGQDLTDEDINRIM 169

  Fly   130 EVDMNSLPAHRHMPQLQLNFQLEEHQLAQRQACLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAV 194
            |...:.....|.:..|.::.|.....:.:|..   ::::|:..|..|..:|..::.||..|...|
 Worm   170 ENSGSEQLFFREVNPLSVSGQAAYEDVKKRHG---EIKDLENNIAMLEEIFLDLQHLTEAQDEMV 231

  Fly   195 EKIADNAEEALENVQQGELNLRRALTYKKA 224
            ..|.:|.|..||.|:||..|::.|:.|||:
 Worm   232 TNIDNNVENGLEQVKQGSANVKTAVEYKKS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 18/60 (30%)
syx-2NP_510323.3 SynN 30..178 CDD:238105 27/137 (20%)
Syntaxin 44..227 CDD:279182 37/189 (20%)
SNARE_syntaxin1-like 192..254 CDD:277201 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.