DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx17 and syx-16

DIOPT Version :9

Sequence 1:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001379771.1 Gene:syx-16 / 175712 WormBaseID:WBGene00022534 Length:329 Species:Caenorhabditis elegans


Alignment Length:241 Identity:53/241 - (21%)
Similarity:97/241 - (40%) Gaps:50/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QAEVSIQRFQ------DVAVPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQIKNLLL 69
            |.|..::|.|      ..|...|:|     |.|      .|| :..:|||....:..:||..:|.
 Worm    84 QVEFEVERVQRRLDELGEAQRKHIS-----RPN------FGD-EAFEKEEKQMEQTTEQITQMLT 136

  Fly    70 EMDALREKV-----REEDLERFDDLMKPGRDTAFAGMK--------EFAELQLK--SPTSTLSSQ 119
            ....|...:     :|:.::|      ..|:.|.|.:.        ||...|||  |.....|..
 Worm   137 HCQRLIRMISGSHNKEKPMQR------KLRENAAATLSLTLSQITDEFRGRQLKYLSDIQNRSRN 195

  Fly   120 YD------DDLDNQPQEVDMNSLPAHR-HMPQLQLNFQLEEHQLAQRQACLDQMENLQQEIYDLH 177
            .|      |.|.:.|...:::..|:.. .|.||| .|...:.::.:|:   .::..:...|.:|:
 Worm   196 VDNYLITTDPLIDAPNWAELDVSPSTEISMAQLQ-QFMNNDREVRERE---KEVMAVNTSIRELN 256

  Fly   178 GMFQGMRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK 223
            .:||.:.::..:|...:::|..|.|:....|.:...::.:|..|:|
 Worm   257 TLFQDLSEMIVDQGSVIDRIDYNVEQTSIRVSKAVEDVFKAERYQK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 10/60 (17%)
syx-16NP_001379771.1 COG5325 69..316 CDD:227635 53/241 (22%)
SNARE_syntaxin16 238..296 CDD:277198 10/60 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.