DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and PROZ

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_016876301.1 Gene:PROZ / 8858 HGNCID:9460 Length:467 Species:Homo sapiens


Alignment Length:192 Identity:51/192 - (26%)
Similarity:79/192 - (41%) Gaps:30/192 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 QRTVTMPV-KRTEVYSRPTWKHVATPCQPPTFSG---QKCTRVQVVHEQAYRDVIDHKTAQQMTY 311
            |.::.:|. |..:|..|  ||...:......|.|   ::|.....|:|:| |:|.:::....   
Human    88 QESLFLPASKANDVLVR--WKRAGSYLLEELFEGNLEKECYEEICVYEEA-REVFENEVVTD--- 146

  Fly   312 DCCTGWSRENPRSDSCMKPICSARCQNGGNCTAP---STCSCPTGFTGRFCEQDVDECQTEKP-- 371
               ..|.|....|     |..|..|.:.|:|...   .||:|..|:.|..||...:||..|:.  
Human   147 ---EFWRRYKGGS-----PCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDG 203

  Fly   372 CDQQCINTHGSYFCRCRQGFVLQSDQQSCKK-------VSTNADDAFEARDLENDIDDTDAE 426
            |...|:....||.|.|.||:.|..|.:.|..       |.|:...|.:.:||...:..|::|
Human   204 CQHFCLPGQESYTCSCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877 15/70 (21%)
EGF_CA <336..360 CDD:238011 8/26 (31%)
EGF_CA 362..401 CDD:214542 13/40 (33%)
PROZXP_016876301.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.