DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and Egfl8

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_690886.3 Gene:Egfl8 / 81701 MGIID:1932094 Length:293 Species:Mus musculus


Alignment Length:205 Identity:66/205 - (32%)
Similarity:102/205 - (49%) Gaps:28/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 ICMQQRTVTMPVKRTEVYSRPTWKHVATPCQPPTFSGQK-CTRVQVVHEQAYRDVIDHKTAQQMT 310
            :|.:| |:.:|::..|.||:|.:|...|.|     :|:: |:..:..:..|:|:|  .:...|..
Mouse    37 VCSKQ-TLLVPLRYNESYSQPVYKPYLTLC-----AGRRICSTYRTTYRVAWREV--RREVPQTH 93

  Fly   311 YDCCTGWSRENPRSDSCMKPICSARCQNGGNCTAPSTCSCPTGFTGRFCEQDVDECQTEKP-CDQ 374
            ..||.||.:.:|.:.:| ..|||..|.|||.||.|..|.|..|:.|:.|..|||||:.... |..
Mouse    94 VVCCQGWKKPHPGALTC-DAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSH 157

  Fly   375 QCINTHGSYFCRCRQGFVLQSDQQSCK-------------KVSTNADDAFEARDLENDIDDTDAE 426
            .|:||.||:.|.|....||..|.::|.             .|:....|:.|.|.|..::    ||
Mouse   158 GCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEV----AE 218

  Fly   427 VATRLQKIEK 436
            :..||:|:|:
Mouse   219 LRGRLEKLEQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877 20/71 (28%)
EGF_CA <336..360 CDD:238011 11/23 (48%)
EGF_CA 362..401 CDD:214542 16/39 (41%)
Egfl8NP_690886.3 EMI 37..101 CDD:400092 20/71 (28%)
EGF_CA 144..183 CDD:214542 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BEDX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001719
OrthoInspector 1 1.000 - - otm44166
orthoMCL 1 0.900 - - OOG6_109468
Panther 1 1.100 - - O PTHR14949
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5266
SonicParanoid 1 1.000 - - X4227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.