DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and egfl8

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:XP_012824045.1 Gene:egfl8 / 779640 XenbaseID:XB-GENE-478327 Length:300 Species:Xenopus tropicalis


Alignment Length:286 Identity:83/286 - (29%)
Similarity:142/286 - (49%) Gaps:39/286 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 GYPTDPK-EMERRHICMQQRTVTMPVKRTEVYSRPTWKHVATPCQPPTFSGQKCTRVQVVHEQAY 297
            |..|..| ..:.|.:|.:| ...:||...|.:.:|.::...|.||    ..:.|::.:.|:..:.
 Frog    32 GVTTQAKASRDNRGVCSRQ-VERVPVLYNETFIQPKYQPYLTTCQ----GYRACSKYRTVYTVSV 91

  Fly   298 RDVIDHKTAQQMTYDCCTGWSRENPRSDSCMKPICSARCQNGGNCTAPSTCSCPTGFTGRFCEQD 362
            |.:  .|...::...||.||.::.|.|:.|.:.:|...|||||.|..|:.|.||.|:.||:|..|
 Frog    92 RQM--KKELLRVKSVCCPGWKKKEPTSEDCEEALCHKPCQNGGTCVKPNMCRCPAGWGGRYCHVD 154

  Fly   363 VDEC-QTEKPCDQQCINTHGSYFCRCRQGFVLQSDQQSCKK-------VSTNADDAFEARDLEND 419
            :||| :..|||.|.||||.|||.|.|:.||.|..|.:||.:       .:..|:||  :..|.|:
 Frog   155 IDECRRPSKPCPQLCINTRGSYRCECQPGFTLGEDGKSCTENKAPSQLPAQQAEDA--SHRLSNE 217

  Fly   420 IDDTDAEVATRLQKIEKSLAN---------ERVHTNELQKSLQATYSV--VDTLKSRLSTLEKQA 473
            |.:....|.|..|:::.:|:.         ..:|::::.:..:...|:  :|:...:|..:|::.
 Frog   218 IQELRNLVETLEQRLDSTLSAVQRLFPVKLSEIHSDQVHEFWERIQSLDRMDSFSDQLMYMEEKM 282

  Fly   474 QDVSRLQTNLYKTESRTNKLEGMLNL 499
            .:.|          .|:|::|..:||
 Frog   283 GECS----------CRSNEIEMAVNL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877 16/71 (23%)
EGF_CA <336..360 CDD:238011 13/23 (57%)
EGF_CA 362..401 CDD:214542 22/39 (56%)
egfl8XP_012824045.1 EMI 46..110 CDD:369419 16/70 (23%)
EGF_CA 154..193 CDD:311536 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4456
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001719
OrthoInspector 1 1.000 - - oto105205
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5266
SonicParanoid 1 1.000 - - X4227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.080

Return to query results.
Submit another query.