DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and egfl7

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001035475.1 Gene:egfl7 / 678640 ZFINID:ZDB-GENE-040429-2 Length:277 Species:Danio rerio


Alignment Length:253 Identity:76/253 - (30%)
Similarity:125/253 - (49%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RHIC---MQQRTVTMPVKRTEVYSRPTWKHVATPCQPPTFSGQKCTRVQVVHEQAYRDVIDHKTA 306
            |.:|   :..|.|:.   .||.:.:|..|...|.||    :.:.|:..:.:::.:||.|......
Zfish    28 RRVCVGDVWSRRVSY---STESFLQPVHKPYITMCQ----NHRMCSTYKTIYKVSYRQVSRAAPN 85

  Fly   307 QQMTYDCCTGWSRENPRSDSCMKPICSARCQNGGNCTAPSTCSCPTGFTGRFCEQDVDECQTEKP 371
            .|:..:||.||.|.:  |.:|.:.:|...|.|||:|..|:.|:|..|:|||||:.|||||:..:.
Zfish    86 LQIYPECCPGWRRMH--SHNCNQAVCEQSCANGGSCVRPNHCACLRGWTGRFCQIDVDECKEAQS 148

  Fly   372 CDQQCINTHGSYFCRCRQGFVLQSDQQSCKKVSTNADDAFEARDLENDIDDTDAEVATRL----Q 432
            |.|:|:||.||:.|.|.:||.|..|:.:|.|...::.:......|..::.:....:..|:    |
Zfish   149 CSQKCVNTLGSFQCVCEEGFSLDEDKVTCSKNPASSRNTGGGLGLVENVTEEVQILKNRVELLEQ 213

  Fly   433 KIEKSLA------------------NERVHTNELQKSLQATYSVVDTLKSRLSTLEKQ 472
            |:|..||                  :||  ||.|..||| ....:::|..::..||::
Zfish   214 KLEMVLAPFTTLLPLDGAGDTNSFLSER--TNFLSHSLQ-QLDRIESLSEQVGFLEER 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877 18/74 (24%)
EGF_CA <336..360 CDD:238011 13/23 (57%)
EGF_CA 362..401 CDD:214542 18/38 (47%)
egfl7NP_001035475.1 EMI 29..97 CDD:284877 18/74 (24%)
EGF_CA 139..169 CDD:214542 15/29 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9427
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001719
OrthoInspector 1 1.000 - - oto38997
orthoMCL 1 0.900 - - OOG6_109468
Panther 1 1.100 - - LDO PTHR14949
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.