DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and Proz

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_080110.1 Gene:Proz / 66901 MGIID:1860488 Length:399 Species:Mus musculus


Alignment Length:287 Identity:66/287 - (22%)
Similarity:109/287 - (37%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 TVTMPV-KRTEVYSRPTWKHVATPCQPPTFSGQKCTRVQVVHEQAYRDVIDHKTAQQM-TYDCCT 315
            :|.:|. |...|..|  |:..::......|.|.       :.::.|.:|.:::.|::: ..|..|
Mouse    23 SVFLPAPKANNVLRR--WRRGSSYFLEEIFQGN-------LEKECYEEVCNYEEAREVFENDVIT 78

  Fly   316 G--WSRENPRSDSCMKPICSARCQNGGNC---TAPSTCSCPTGFTGRFCEQDVDECQTEKP--CD 373
            .  |.:....|     |..|..|.|.|.|   ....:|:|..|:.|:.|....:||..|:.  |.
Mouse    79 DEFWRQYGGGS-----PCVSQPCLNNGTCEDHIRSYSCTCSPGYEGKTCAMAKNECHLERTDGCQ 138

  Fly   374 QQCINTHGSYFCRCRQGFVLQSDQQSCKKVSTNADDAFEARDLENDIDDTDAEVATRLQKIEKSL 438
            ..|.....||.|.|.:|:.|..||:||......|..|..:..:             |:.|..:|.
Mouse   139 HFCHPGQSSYMCSCAKGYKLGKDQKSCGPSDKCACGALTSEHI-------------RMTKSSQSQ 190

  Fly   439 AN----ERVHTNE---------LQKSLQATYSVVDTLKSRLSTLEKQAQDVSRLQTNL---YKTE 487
            .:    .|:..:|         ||:....|.:....|.|.:|......|.:....|::   |..|
Mouse   191 PSFPWQVRLTNSEGEDFCAGVLLQEDFVLTTAKCSLLHSNISVKANVDQRIRIKSTHVHMRYDEE 255

  Fly   488 SRTNKLEGMLNL--LLKCRNGPNANCP 512
            |..|.: .:|.|  .|:|   |::..|
Mouse   256 SGENDV-SLLQLEEPLQC---PSSGLP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877 13/68 (19%)
EGF_CA <336..360 CDD:238011 8/26 (31%)
EGF_CA 362..401 CDD:214542 14/40 (35%)
ProzNP_080110.1 GLA 23..85 CDD:214503 14/70 (20%)
EGF_CA <95..122 CDD:238011 8/26 (31%)
FXa_inhibition 136..165 CDD:291342 10/28 (36%)
Tryp_SPc 192..397 CDD:304450 20/91 (22%)
Trypsin 192..>340 CDD:278516 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.