DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and EGFL7

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_057299.1 Gene:EGFL7 / 51162 HGNCID:20594 Length:273 Species:Homo sapiens


Alignment Length:250 Identity:73/250 - (29%)
Similarity:117/250 - (46%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RHICMQQRTVTMPVKRTEVYSRPTWKHVATPCQPPTFSGQKCTRVQVVHEQAYRDVIDHKTAQQM 309
            |.:| ..|....||  :|.:.:..::...|.|.    ..:.|:..:.::..|||.......|:. 
Human    28 RRVC-AVRAHGDPV--SESFVQRVYQPFLTTCD----GHRACSTYRTIYRTAYRRSPGLAPARP- 84

  Fly   310 TYDCCTGWSRENPRSDSCMKPICSARCQNGGNCTAPSTCSCPTGFTGRFCEQDVDECQTEK-PCD 373
            .|.||.||.|.:....:|...||...|:|||:|..|..|.||.|:.|..|:.|||||...: .|.
Human    85 RYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCP 149

  Fly   374 QQCINTHGSYFCRCRQGFVLQSDQQSC------KKVS---TNADDAF--EARDLENDIDDTDAEV 427
            |:|:||.|||:|:|.:|..|.:|...|      .:|:   |..|.|.  |.:.|::.:|..:.::
Human   150 QRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKL 214

  Fly   428 ATRLQKIEKSLANERVHTNELQKSLQATYSV----------VDTLKSRLSTLEKQ 472
            ...|..:. |||::     .|:..|....|:          :|:|..::|.||:|
Human   215 QLVLAPLH-SLASQ-----ALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877 16/71 (23%)
EGF_CA <336..360 CDD:238011 11/23 (48%)
EGF_CA 362..401 CDD:214542 19/45 (42%)
EGFL7NP_057299.1 EMI 29..93 CDD:369419 16/71 (23%)
EGF_CA <110..135 CDD:238011 11/24 (46%)
Cell attachment site 130..132 0/1 (0%)
FXa_inhibition 141..176 CDD:373209 14/34 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BEDX
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9427
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7458
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001719
OrthoInspector 1 1.000 - - otm42111
orthoMCL 1 0.900 - - OOG6_109468
Panther 1 1.100 - - LDO PTHR14949
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.