DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and Egfl8

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001004070.1 Gene:Egfl8 / 406166 RGDID:1549706 Length:291 Species:Rattus norvegicus


Alignment Length:200 Identity:66/200 - (33%)
Similarity:106/200 - (53%) Gaps:19/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 ICMQQRTVTMPVKRTEVYSRPTWKHVATPCQPPTFSGQK-CTRVQVVHEQAYRDVIDHKTAQQMT 310
            :|.:| |:.:|::..|.||:|.::...|.|     :|:: |:..:..:..|:|:|  .:..||..
  Rat    36 VCSKQ-TLLVPLRYNESYSQPVYRPYLTLC-----AGRRICSTYRTTYRVAWREV--RREVQQTH 92

  Fly   311 YDCCTGWSRENPRSDSCMKPICSARCQNGGNCTAPSTCSCPTGFTGRFCEQDVDECQTEKP-CDQ 374
            ..||.||.:.:|.:.:| :.|||..|.|||.|..|..|.|.:|:.|:.|..|||||:|... |..
  Rat    93 VVCCQGWKKPHPGALTC-EAICSKPCLNGGVCAGPDQCECASGWAGKHCHVDVDECRTSLTLCSH 156

  Fly   375 QCINTHGSYFCRCRQGFVLQSDQQSC----KKVSTNAD----DAFEARDLENDIDDTDAEVATRL 431
            .|:||.||:.|.|....||..|.::|    .:.||:|.    ...||...|:.:....||:..||
  Rat   157 GCLNTLGSFTCSCPNPLVLGPDGRACAGGPPESSTSAGILSVAVREADSEEHALRREVAELRGRL 221

  Fly   432 QKIEK 436
            :::|:
  Rat   222 ERLEQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877 20/71 (28%)
EGF_CA <336..360 CDD:238011 10/23 (43%)
EGF_CA 362..401 CDD:214542 18/43 (42%)
Egfl8NP_001004070.1 EMI 36..100 CDD:400092 20/71 (28%)
vWFA <108..181 CDD:412136 32/73 (44%)
EGF_CA 143..>170 CDD:214542 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BEDX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001719
OrthoInspector 1 1.000 - - otm46257
orthoMCL 1 0.900 - - OOG6_109468
Panther 1 1.100 - - O PTHR14949
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.