DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and egas-4

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_501207.2 Gene:egas-4 / 3564809 WormBaseID:WBGene00018906 Length:883 Species:Caenorhabditis elegans


Alignment Length:211 Identity:52/211 - (24%)
Similarity:87/211 - (41%) Gaps:60/211 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 CQNGGNCT----APST--CSCPTGFTGRFCEQDVDE-------CQTEKPCDQQCINTHGSYFCRC 387
            |:|||.|.    .|::  |:|...:||..|..||||       |:|:.| |..|:||:|||:|.|
 Worm   450 CENGGECEDIIGPPNSYNCTCTPQWTGFNCTIDVDECVEDTTLCKTKDP-DATCVNTNGSYYCVC 513

  Fly   388 RQGFVLQSDQQSC--KKVSTNADDAFEARDLENDIDDTDAEVATRLQKIEKSLANERVHTNELQK 450
            .....    .:||  .|:.....:|... ||..|          :|.::.:.|.|:.....::..
 Worm   514 SPNMF----GKSCLFNKIIYQILNATYG-DLGPD----------KLDEMAQELTNDPTLVRDIVP 563

  Fly   451 SLQATYSVVDTLKSRLS----------TLEKQAQDVSR--LQTN---------------LYKTES 488
            .|...||:  .:::.||          ..|:|..|::.  :|.|               .:|.|:
 Worm   564 FLIGGYSL--EVRTSLSWTAADMFLWVAYEQQLIDLNSNFVQWNDKVLGNCFTFNHMNSSFKYEA 626

  Fly   489 RTNKLEGMLNLLLKCR 504
            |::...|.|.:.:..:
 Worm   627 RSSGYPGGLEMQMNVK 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877
EGF_CA <336..360 CDD:238011 10/29 (34%)
EGF_CA 362..401 CDD:214542 18/47 (38%)
egas-4NP_501207.2 EGF 101..131 CDD:278437
EGF_CA 482..522 CDD:238011 16/44 (36%)
ASC <610..869 CDD:279230 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7458
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.