DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and Megf6

DIOPT Version :10

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001156449.1 Gene:Megf6 / 230971 MGIID:1919351 Length:1572 Species:Mus musculus


Alignment Length:190 Identity:57/190 - (30%)
Similarity:91/190 - (47%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PTDPKEMERRHICMQQRTVTMPVKR--TEVYSR--PTWKHVATPCQPPTFSGQKCTRV----QVV 292
            |..|.:....|:|.:|:...:..::  .:.:||  |.|:   :.|      ||:...|    :.|
Mouse    32 PPRPLQPSMPHVCAEQKLTLVGHRQPCVQAFSRVVPVWR---SGC------GQQAWCVGQERRTV 87

  Fly   293 HEQAYRDVIDHKTAQQMTYDCCTGWSRENPRSDSCMKPICSARCQNGGNCTAPST-------CSC 350
            :..:||.|  :.|..:..:.||.||| :.|..:.|:..:......||| |..|..       |.|
Mouse    88 YYMSYRQV--YATEARTVFRCCPGWS-QKPGQEGCLSDVDECANANGG-CEGPCCNTVGGFYCRC 148

  Fly   351 PTGF----TGRFCEQDVDECQTEK-PCDQQCINTHGSYFCRCRQGFVLQSDQQSCKKVST 405
            |.|:    .|:.| ||||||::.. .|..:|:||.|||.|.|:.||.|.:|.::|..:|:
Mouse   149 PPGYQLQGDGKTC-QDVDECRSHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCLAISS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 245..319 CDD:462204 20/81 (25%)
EGF_CA <336..360 CDD:238011 10/34 (29%)
EGF_CA 362..401 CDD:214542 18/39 (46%)
Megf6NP_001156449.1 EMI 41..112 CDD:462204 21/82 (26%)
FXa_inhibition 126..161 CDD:464251 10/35 (29%)
vWFA <153..201 CDD:469594 21/48 (44%)
FXa_inhibition 208..244 CDD:464251 57/190 (30%)
FXa_inhibition 250..285 CDD:464251
vWFA <283..324 CDD:469594
FXa_inhibition 337..372 CDD:464251
vWFA <370..409 CDD:469594
vWFA <412..451 CDD:469594
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.