DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slow and mec-9

DIOPT Version :9

Sequence 1:NP_647898.3 Gene:slow / 38540 FlyBaseID:FBgn0035539 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001256153.1 Gene:mec-9 / 179382 WormBaseID:WBGene00003173 Length:838 Species:Caenorhabditis elegans


Alignment Length:286 Identity:61/286 - (21%)
Similarity:92/286 - (32%) Gaps:108/286 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 WKHVATPCQ-PPTFSGQKCTRVQVVHEQAYRDVIDHKTAQQMTYDCCTGWSRENPRSDSCMKPIC 332
            ||.....|: .|.|.|..|.:|                   :.||.|.    |.|          
 Worm   568 WKKDTHYCKCQPGFHGNNCDKV-------------------VDYDPCA----EKP---------- 599

  Fly   333 SARCQNGGNC----------TAPS-TCSCPTGFTGRFCEQDVDECQTEKPCDQQ-CINT------ 379
               |.||..|          ..|: .|.|..||.|..|:|        :||:.. |:|.      
 Worm   600 ---CLNGATCQIKYNDDDVDEKPTFECFCAAGFGGPKCDQ--------RPCESNPCLNNGTCRTT 653

  Fly   380 --HGSYFCRCRQGFVLQSDQQSCKKVS---TNADDAF--EARDLENDIDDTDAEVATRLQKI--- 434
              :.:|||.|..||    ..::| .||   |..::.|  ....:.:..::..|::..||::.   
 Worm   654 KGYSTYFCECANGF----GGKNC-DVSIGNTPPEEKFGKNVEQISSGKEEWIAQMRQRLKETGGG 713

  Fly   435 ---------------------EKSLANERVHTNELQKSLQAT---YSVVDTLKSRLSTLEK---- 471
                                 ||| ..::...|:..|:.|..   |....|.|......||    
 Worm   714 IGGASGSGLKSENGTMGGSSGEKS-GEKKSGKNKKSKATQVADEPYKDPATRKREREEREKKEAE 777

  Fly   472 -QAQDVSRLQTNLYKTESRTNKLEGM 496
             ||.:....|...|:.:::..|.|.|
 Worm   778 IQAAEEEEKQRKEYEEDAQRKKAEEM 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slowNP_647898.3 EMI 246..318 CDD:284877 11/49 (22%)
EGF_CA <336..360 CDD:238011 10/34 (29%)
EGF_CA 362..401 CDD:214542 10/47 (21%)
mec-9NP_001256153.1 Kunitz_BPTI 35..87 CDD:278443
Kunitz_BPTI 100..154 CDD:278443
EGF_CA 199..238 CDD:284955
EGF_3 283..318 CDD:289699
KU 323..381 CDD:197529
KU <408..449 CDD:197529
KU 460..516 CDD:197529
EGF_CA 550..586 CDD:238011 6/17 (35%)
EGF 639..671 CDD:278437 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.