Sequence 1: | NP_647898.3 | Gene: | slow / 38540 | FlyBaseID: | FBgn0035539 | Length: | 512 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001256153.1 | Gene: | mec-9 / 179382 | WormBaseID: | WBGene00003173 | Length: | 838 | Species: | Caenorhabditis elegans |
Alignment Length: | 286 | Identity: | 61/286 - (21%) |
---|---|---|---|
Similarity: | 92/286 - (32%) | Gaps: | 108/286 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 269 WKHVATPCQ-PPTFSGQKCTRVQVVHEQAYRDVIDHKTAQQMTYDCCTGWSRENPRSDSCMKPIC 332
Fly 333 SARCQNGGNC----------TAPS-TCSCPTGFTGRFCEQDVDECQTEKPCDQQ-CINT------ 379
Fly 380 --HGSYFCRCRQGFVLQSDQQSCKKVS---TNADDAF--EARDLENDIDDTDAEVATRLQKI--- 434
Fly 435 ---------------------EKSLANERVHTNELQKSLQAT---YSVVDTLKSRLSTLEK---- 471
Fly 472 -QAQDVSRLQTNLYKTESRTNKLEGM 496 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slow | NP_647898.3 | EMI | 246..318 | CDD:284877 | 11/49 (22%) |
EGF_CA | <336..360 | CDD:238011 | 10/34 (29%) | ||
EGF_CA | 362..401 | CDD:214542 | 10/47 (21%) | ||
mec-9 | NP_001256153.1 | Kunitz_BPTI | 35..87 | CDD:278443 | |
Kunitz_BPTI | 100..154 | CDD:278443 | |||
EGF_CA | 199..238 | CDD:284955 | |||
EGF_3 | 283..318 | CDD:289699 | |||
KU | 323..381 | CDD:197529 | |||
KU | <408..449 | CDD:197529 | |||
KU | 460..516 | CDD:197529 | |||
EGF_CA | 550..586 | CDD:238011 | 6/17 (35%) | ||
EGF | 639..671 | CDD:278437 | 9/35 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |