Sequence 1: | NP_001014559.1 | Gene: | DopEcR / 38539 | FlyBaseID: | FBgn0035538 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334987.1 | Gene: | adra1ab / 557259 | ZFINID: | ZDB-GENE-060503-384 | Length: | 431 | Species: | Danio rerio |
Alignment Length: | 327 | Identity: | 82/327 - (25%) |
---|---|---|---|
Similarity: | 141/327 - (43%) | Gaps: | 54/327 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 LTKAVLISILGVAIVL-------SNLLIIATYANFKGPTEVINYYLLSLAIADLLCGLLVVPFSV 73
Fly 74 YPALTGEWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVF 138
Fly 139 TWISAALLCCPPILGYSMPIENNMTHICML--DWGNMAAYSATLAILVLGPSLISIVHNYGYIFV 201
Fly 202 M-------MRKIRSGEPIHDKEYATAL----AEN---------LSNPSH-----MMSFA------ 235
Fly 236 -----LVFAFWVSWLPWILLRLYEVVTGDVIQSTLINFAVVWIGILNSFWKILIMTSMSPQFRIA 295
Fly 296 LR 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DopEcR | NP_001014559.1 | 7tm_classA_rhodopsin-like | 18..289 | CDD:410626 | 78/315 (25%) |
TM helix 1 | 18..42 | CDD:410626 | 8/30 (27%) | ||
TM helix 2 | 51..73 | CDD:410626 | 11/21 (52%) | ||
TM helix 3 | 89..111 | CDD:410626 | 4/21 (19%) | ||
TM helix 4 | 134..150 | CDD:410626 | 2/15 (13%) | ||
TM helix 5 | 174..197 | CDD:410626 | 6/22 (27%) | ||
TM helix 6 | 230..252 | CDD:410626 | 8/37 (22%) | ||
TM helix 7 | 264..289 | CDD:410626 | 5/24 (21%) | ||
adra1ab | XP_021334987.1 | 7tm_GPCRs | 48..349 | CDD:333717 | 75/306 (25%) |
TM helix 2 | 72..94 | CDD:320095 | 11/21 (52%) | ||
TM helix 3 | 110..132 | CDD:320095 | 4/21 (19%) | ||
TM helix 4 | 155..171 | CDD:320095 | 2/15 (13%) | ||
TM helix 5 | 192..215 | CDD:320095 | 7/26 (27%) | ||
TM helix 6 | 280..305 | CDD:320095 | 6/24 (25%) | ||
TM helix 7 | 317..342 | CDD:320095 | 5/24 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |