DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and Dop1R2

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001263072.1 Gene:Dop1R2 / 43484 FlyBaseID:FBgn0266137 Length:807 Species:Drosophila melanogaster


Alignment Length:412 Identity:99/412 - (24%)
Similarity:147/412 - (35%) Gaps:130/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NSKVEALTKAVLISILGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIADLLCGLLVVPFS-V 73
            |.:|..|....|.|.   |.|..|.|:|......:......||::.|||:||.|.||:|:||| :
  Fly   106 NDRVGLLAFLFLFSF---ATVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSAL 167

  Fly    74 YPALTGEWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVF 138
            |..|...|.:|...|.....|:|.....|:.....||:|||.|:..|..|....|..|....:..
  Fly   168 YEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAA 232

  Fly   139 TWISAALLCCPPILGYSMPIENNMTHICMLDWGNMAAYSAT----LAILVLGPS------LISIV 193
            .||.::.:..|.|:.:....:           |.|.||..|    |..||...:      |:.:|
  Fly   233 VWICSSAISFPAIVWWRAARD-----------GEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMV 286

  Fly   194 HNYGYIF----VMMRKIR---------SGE-----PIH--------------------------- 213
            ..|..|:    :..|.::         |||     .||                           
  Fly   287 FTYCRIYRAAVIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGG 351

  Fly   214 ----------------------------DKEYATALAEN-LSNPSHM-MSFAL-----VFA---- 239
                                        |.|..:||..| |:...|| .:|:|     .||    
  Fly   352 SLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRHMGKNFSLSRKLAKFAKEKK 416

  Fly   240 -----------FWVSWLPWILLRLYEVVTGDVIQ----STLINFAVVWIGILNSFWKILIMTSMS 289
                       |.:.|||:.::.|   ::|..|:    ..:::..|.|:|.:||....:|....|
  Fly   417 AAKTLGIVMGVFIICWLPFFVVNL---LSGFCIECIEHEEIVSAIVTWLGWINSCMNPVIYACWS 478

  Fly   290 PQFRIA-LRVFCLTICCKTKGR 310
            ..||.| :|:.|:  ||..|.|
  Fly   479 RDFRRAFVRLLCM--CCPRKIR 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 86/380 (23%)
TM helix 1 18..42 CDD:410626 7/23 (30%)
TM helix 2 51..73 CDD:410626 14/22 (64%)
TM helix 3 89..111 CDD:410626 4/21 (19%)
TM helix 4 134..150 CDD:410626 2/15 (13%)
TM helix 5 174..197 CDD:410626 8/32 (25%)
TM helix 6 230..252 CDD:410626 10/42 (24%)
TM helix 7 264..289 CDD:410626 6/24 (25%)
Dop1R2NP_001263072.1 7tm_4 123..>295 CDD:304433 52/182 (29%)
7tm_1 125..474 CDD:278431 81/362 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.