DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and TyrRII

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001262682.1 Gene:TyrRII / 42135 FlyBaseID:FBgn0038541 Length:586 Species:Drosophila melanogaster


Alignment Length:151 Identity:55/151 - (36%)
Similarity:85/151 - (56%) Gaps:2/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SYLQDNSKVEALTKAVLISILGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIADLLCGLLVV 69
            |||...:..::|..||.:.|:.|.:|.:.|:|:|.....:..| |.|.::::|||.|.|.|..|:
  Fly    65 SYLVSMAWPKSLAVAVFLVIILVTVVGNTLVILAVLTTRRLRT-VTNCFVMNLAITDWLVGTCVM 128

  Fly    70 PFSVYPALTGEWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQC 134
            |.||...:||.|.:|.|:|.....|::.|.:.|:.:...||:||||||.:||.|...:...|...
  Fly   129 PPSVVLYITGTWRFGWILCDIWISLDILLCSGSILSLCAISLDRYLAVTQPLTYSKKRRSKRLAL 193

  Fly   135 WMVF-TWISAALLCCPPILGY 154
            .|:. .||:|..:.|||.||:
  Fly   194 LMILVVWITALSITCPPYLGW 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 51/138 (37%)
TM helix 1 18..42 CDD:410626 8/23 (35%)
TM helix 2 51..73 CDD:410626 9/21 (43%)
TM helix 3 89..111 CDD:410626 4/21 (19%)
TM helix 4 134..150 CDD:410626 5/16 (31%)
TM helix 5 174..197 CDD:410626
TM helix 6 230..252 CDD:410626
TM helix 7 264..289 CDD:410626
TyrRIINP_001262682.1 7tm_4 82..>212 CDD:304433 47/130 (36%)
7tm_1 91..>277 CDD:278431 46/125 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.