DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and mAChR-B

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_649764.1 Gene:mAChR-B / 40955 FlyBaseID:FBgn0037546 Length:1019 Species:Drosophila melanogaster


Alignment Length:147 Identity:49/147 - (33%)
Similarity:82/147 - (55%) Gaps:10/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALTKAVLISI-LGVAIVLS---NLLIIATY---ANFKGPTEVINYYLLSLAIADLLCGLLVVPFS 72
            ||.:.:||:| |.:.|:|:   |:|::..:   .|.:.|:   ||::.|||..|:|.|.:.:||.
  Fly   129 ALWQTILIAICLAICIILTVGGNILVLLAFIVDRNIRQPS---NYFIASLAATDMLIGTVSMPFY 190

  Fly    73 VYPALTGEWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMV 137
            ....|.|.|..|.::|.....::.|:..||.||.:.|::|||.:|:...:|.:.:|:||....:.
  Fly   191 TIYVLKGYWDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIAAKYRSWRTRTRVIYMVT 255

  Fly   138 FTWISAALLCCPPILGY 154
            .|||..|||....|.|:
  Fly   256 ITWIIPALLFFISIFGW 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 47/144 (33%)
TM helix 1 18..42 CDD:410626 8/30 (27%)
TM helix 2 51..73 CDD:410626 10/21 (48%)
TM helix 3 89..111 CDD:410626 6/21 (29%)
TM helix 4 134..150 CDD:410626 6/15 (40%)
TM helix 5 174..197 CDD:410626
TM helix 6 230..252 CDD:410626
TM helix 7 264..289 CDD:410626
mAChR-BNP_649764.1 7tm_1 150..>341 CDD:278431 41/126 (33%)
7tm_4 150..>336 CDD:304433 41/126 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.