DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and Dop2R

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001014758.2 Gene:Dop2R / 33007 FlyBaseID:FBgn0053517 Length:905 Species:Drosophila melanogaster


Alignment Length:223 Identity:62/223 - (27%)
Similarity:112/223 - (50%) Gaps:9/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AVLISILGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIADLLCGLLVVPFSVYPALTGEWMY 83
            |:::.:..:..:..|:|:|.:....:....|.||:::||||||||..::|:||:||..:.|.|..
  Fly   379 ALILILFPILTLFGNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLVNGAWAL 443

  Fly    84 GDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVFTWISAALLCC 148
            .|:||.|...::|.....|::..:.||:|||:||.:|::|...:...|....::..|..:|.:..
  Fly   444 PDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGS 508

  Fly   149 PPILGYSMPIENNMTHICMLDWGNMAAYSATLAILVLGPSLISIVHNYGYIFVMM----RKIRSG 209
            |.:||.: ...|....:|.....:...||:..:..:  |.:| :|..|..||..:    ||.|:.
  Fly   509 PIVLGLN-NTPNREPDVCAFYNADFILYSSLSSFYI--PCII-MVFLYWNIFKALRSRARKQRAA 569

  Fly   210 EPIHDKEY-ATALAENLSNPSHMMSFAL 236
            ...|..|. ..::.||::....:...||
  Fly   570 RKPHLSELTGGSVIENIAQTRRLAETAL 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 62/223 (28%)
TM helix 1 18..42 CDD:410626 4/22 (18%)
TM helix 2 51..73 CDD:410626 13/21 (62%)
TM helix 3 89..111 CDD:410626 4/21 (19%)
TM helix 4 134..150 CDD:410626 2/15 (13%)
TM helix 5 174..197 CDD:410626 5/22 (23%)
TM helix 6 230..252 CDD:410626 2/7 (29%)
TM helix 7 264..289 CDD:410626
Dop2RNP_001014758.2 7tmA_D2-like_dopamine_R 376..>565 CDD:320181 53/189 (28%)
TM helix 1 377..403 CDD:320181 4/23 (17%)
TM helix 2 410..436 CDD:320181 15/25 (60%)
TM helix 3 448..478 CDD:320181 10/29 (34%)
TM helix 4 490..513 CDD:320181 4/22 (18%)
TM helix 5 529..558 CDD:320181 8/31 (26%)
7tm_GPCRs <822..898 CDD:333717
TM helix 6 825..850 CDD:320095
TM helix 7 866..891 CDD:320095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.