DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and Gpr101

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001028532.1 Gene:Gpr101 / 245424 MGIID:2685211 Length:511 Species:Mus musculus


Alignment Length:194 Identity:60/194 - (30%)
Similarity:92/194 - (47%) Gaps:9/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTKAVLISILGVAIVLSNLLIIATYANFKGPT--EVINYYLLSLAIADLLCGLLVVPFSVYPALT 78
            :...||:.|||||. |.|  ::..|...:.|.  :|.|.::.:|.:.|||...||.|:.|..|:.
Mouse    33 IRSVVLLVILGVAF-LGN--VVLGYVLHRKPNLLQVTNRFIFNLLVTDLLQVALVAPWVVSTAIP 94

  Fly    79 GEWMYGDIVCRFTGYLEVT-LWA-VSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVFTWI 141
            ..|......|  |..:.:| |:| .||.|.:.:||||||.:..||.|.:..|..|....:..|||
Mouse    95 FFWPLNIHFC--TALVSLTHLFAFASVNTIVVVSVDRYLTIIHPLSYPSKMTNRRSYILLYGTWI 157

  Fly   142 SAALLCCPPILGYSMPIENNMTHICMLDWGNMAAYSATLAILVLGPSLISIVHNYGYIFVMMRK 205
            :|.|...||:.|:.....::....|.:.||...||:....:..|...|..::..|..:|...|:
Mouse   158 AAFLQSTPPLYGWGHATFDDRNAFCSMIWGASPAYTVVSVVSFLVIPLGVMIACYSVVFGAARR 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 60/192 (31%)
TM helix 1 18..42 CDD:410626 10/23 (43%)
TM helix 2 51..73 CDD:410626 8/21 (38%)
TM helix 3 89..111 CDD:410626 7/23 (30%)
TM helix 4 134..150 CDD:410626 5/15 (33%)
TM helix 5 174..197 CDD:410626 4/22 (18%)
TM helix 6 230..252 CDD:410626
TM helix 7 264..289 CDD:410626
Gpr101NP_001028532.1 7tm_4 44..>165 CDD:304433 42/125 (34%)
7tm_1 48..>233 CDD:278431 52/178 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..315
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..386
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.