DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and Adra2c

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_612515.2 Gene:Adra2c / 24175 RGDID:2058 Length:458 Species:Rattus norvegicus


Alignment Length:136 Identity:40/136 - (29%)
Similarity:70/136 - (51%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AVLISILGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIADLLCGLLVVPFSVYPALTGEWMY 83
            |.::..|.|..|:.|:|::......:......|.:|:|||.||:|...||:|||:...|...|.:
  Rat    55 AAVVGFLIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYF 119

  Fly    84 GDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVFTWISAALLCC 148
            |.:.|.....|:|.....|:.....||:|||.:|.:.:.|...:|..|.:..:|..|:.:|::..
  Rat   120 GQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAVISF 184

  Fly   149 PPILGY 154
            ||::.:
  Rat   185 PPLVSF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 40/136 (29%)
TM helix 1 18..42 CDD:410626 6/22 (27%)
TM helix 2 51..73 CDD:410626 12/21 (57%)
TM helix 3 89..111 CDD:410626 4/21 (19%)
TM helix 4 134..150 CDD:410626 3/15 (20%)
TM helix 5 174..197 CDD:410626
TM helix 6 230..252 CDD:410626
TM helix 7 264..289 CDD:410626
Adra2cNP_612515.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.