DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and Adra2b

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_612514.2 Gene:Adra2b / 24174 RGDID:2057 Length:453 Species:Rattus norvegicus


Alignment Length:219 Identity:62/219 - (28%)
Similarity:106/219 - (48%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QEMSYLQDNSKV-EALTKAVLISILGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIADLLCG 65
            ||...:|..:.: .|:|..:|.:|.|.|:|   :|.:.|..:.:.|.   |.:|:|||.||:|..
  Rat     9 QEPYSVQATAAIASAITFLILFTIFGNALV---ILAVLTSRSLRAPQ---NLFLVSLAAADILVA 67

  Fly    66 LLVVPFSVYPALTGEWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKT 130
            .|::|||:...|.|.|.:....|.....|:|.....|:.....||:|||.||.:.|.|.:.:|..
  Rat    68 TLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPR 132

  Fly   131 RCQCWMVFTWISAALLCCPPIL--GYSMPIENNMTHICMLD---W----GNMAAYSATLAILVLG 186
            |.:|.::..|:.||::..||::  |...|....:.. |.|:   |    .::.::.|...|::|.
  Rat   133 RIKCIILTVWLIAAVISLPPLIYKGDQRPEPRGLPQ-CELNQEAWYILASSIGSFFAPCLIMILV 196

  Fly   187 PSLISIVHNYGYIFVMMRKIRSGE 210
            ...|.::....:...:..|..|||
  Rat   197 YLRIYVIAKRSHCRGLGAKRGSGE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 57/202 (28%)
TM helix 1 18..42 CDD:410626 7/23 (30%)
TM helix 2 51..73 CDD:410626 11/21 (52%)
TM helix 3 89..111 CDD:410626 4/21 (19%)
TM helix 4 134..150 CDD:410626 4/15 (27%)
TM helix 5 174..197 CDD:410626 4/22 (18%)
TM helix 6 230..252 CDD:410626
TM helix 7 264..289 CDD:410626
Adra2bNP_612514.2 7tm_4 26..>157 CDD:304433 44/136 (32%)
7tm_1 34..429 CDD:278431 55/194 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..331 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.