DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and ADRA1B

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_011532737.1 Gene:ADRA1B / 147 HGNCID:278 Length:556 Species:Homo sapiens


Alignment Length:378 Identity:88/378 - (23%)
Similarity:155/378 - (41%) Gaps:96/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTKAVLIS-ILGVAI---VLSNLLIIATYA---NFKGPTEVINYYLLSLAIADLLCGLLVVPFSV 73
            :|:|:.:. :||..|   ::.|:|:|.:.|   :.:.||   ||::::||:||||....|:|||.
Human    42 ITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPT---NYFIVNLAMADLLLSFTVLPFSA 103

  Fly    74 YPALTGEWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVF 138
            ...:.|.|:.|.|.|.....::|.....|:.:...||:|||:.||..|:|.|:.|:.:....::.
Human   104 ALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLS 168

  Fly   139 TWISAALLCCPPILGYSMPIENNMTHICMLDWGNMAAYSATLAILVLGPSLISIVHNYGYIF--- 200
            .|:.:.::...|:||:..|..|:... |.:......|..::|....:..::|.:::...||.   
Human   169 VWVLSTVISIGPLLGWKEPAPNDDKE-CGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKR 232

  Fly   201 --------VMMRKIRSGE---PIHDKEYATALAENLS-------NPSHMMSFAL----------- 236
                    ||.....|.|   .||.|.:.   .:.||       ||...::..|           
Human   233 TTKNLEAGVMKEMSNSKELTLRIHSKNFH---EDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAK 294

  Fly   237 -----VFAFWVSWLPWIL-------------LRLYEVVTGDVIQSTLINFAVV------------ 271
                 |..|.:.|||:.:             ||:.....|   .|:::|..:|            
Human   295 TLGIVVGMFILCWLPFFIALPLDPDSPPPTHLRVVPAPWG---HSSIMNLPLVLPLDATRSGSLF 356

  Fly   272 --------------WIGILNSFWKILIMTSMSPQFRIALRVFCLTICCKTKGR 310
                          |:|..||....:|....|.:|:   |.|...:.|:.:||
Human   357 STLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFK---RAFVRILGCQCRGR 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 80/353 (23%)
TM helix 1 18..42 CDD:410626 8/30 (27%)
TM helix 2 51..73 CDD:410626 11/21 (52%)
TM helix 3 89..111 CDD:410626 3/21 (14%)
TM helix 4 134..150 CDD:410626 1/15 (7%)
TM helix 5 174..197 CDD:410626 3/22 (14%)
TM helix 6 230..252 CDD:410626 7/50 (14%)
TM helix 7 264..289 CDD:410626 7/50 (14%)
ADRA1BXP_011532737.1 7tm_4 57..>181 CDD:304433 37/126 (29%)
7tm_1 62..384 CDD:278431 75/331 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.