DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DopEcR and gpr101

DIOPT Version :9

Sequence 1:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_005173281.1 Gene:gpr101 / 101886313 ZFINID:ZDB-GENE-070914-1 Length:437 Species:Danio rerio


Alignment Length:297 Identity:63/297 - (21%)
Similarity:122/297 - (41%) Gaps:43/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SKVEALTKAVLISILGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIADLLCGLLVVPFSVYP 75
            |.|.:..|.||||.:....:..|::::..:........|.|.::|:|.:||||..:||:||::..
Zfish    25 SLVNSTVKMVLISAIVCTSLFGNIVVLLVFQRKPQLLHVANRFVLNLLLADLLQTVLVMPFAIAA 89

  Fly    76 ALTGEWMYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVFTW 140
            .:...|.....:|:....|........|.|.:.:|:|||||:..||.|.|..|.......:..||
Zfish    90 TVPEVWPLDARLCQALVVLMHLFAFAGVNTIIVVSIDRYLAIIHPLSYPTRMTPHLGTNLIALTW 154

  Fly   141 ISAALLCCPPILGYSMPIENNMTHICMLDWGNMAAYSATLAILVLGPSLISIVHNYGYIF----- 200
            :.:.|...||:.|:.....:...:.|.:.|.:..:|||.::.|.....::.::..|..:|     
Zfish   155 LVSVLQSTPPLYGWGTIDFDRRHNACTVVWSSSYSYSALVSALSFWLPVVIMLCCYWMVFRAARR 219

  Fly   201 --VMMRKIRSGEPIHDKEYATALAENLSNPS-------------------------HMMSFALVF 238
              .::..|:|..|:..:       .:.|:|.                         |..:..:||
Zfish   220 QNALVHPIQSNPPLDSQ-------ASCSSPQRQQQSQQETFSASYPIRTRQRRFQYHCKAARVVF 277

  Fly   239 AFWVSWL----PWILLRLYEVVTGDVIQSTLINFAVV 271
            ....|::    |:.:|....:.:...:...|.:.|::
Zfish   278 VIMASYVLSMGPYSVLSTISIYSSAAVPPWLASTALI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 61/290 (21%)
TM helix 1 18..42 CDD:410626 6/23 (26%)
TM helix 2 51..73 CDD:410626 11/21 (52%)
TM helix 3 89..111 CDD:410626 3/21 (14%)
TM helix 4 134..150 CDD:410626 3/15 (20%)
TM helix 5 174..197 CDD:410626 4/22 (18%)
TM helix 6 230..252 CDD:410626 6/25 (24%)
TM helix 7 264..289 CDD:410626 2/8 (25%)
gpr101XP_005173281.1 7tm_1 46..327 CDD:278431 56/276 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.