| Sequence 1: | NP_001014559.1 | Gene: | DopEcR / 38539 | FlyBaseID: | FBgn0035538 | Length: | 322 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_012824262.2 | Gene: | LOC101735091 / 101735091 | -ID: | - | Length: | 310 | Species: | Xenopus tropicalis |
| Alignment Length: | 243 | Identity: | 49/243 - (20%) |
|---|---|---|---|
| Similarity: | 99/243 - (40%) | Gaps: | 30/243 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 LISILGVAIVLSNLLIIATYANFKGPT--EVINYYLLSLAIADLLCGLLVVPFSVYPALTGE--W 81
Fly 82 MYGDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRC-----QCWMV---- 137
Fly 138 ----FTWISAALLCCPPILGYSMPIENNMTHICMLDWGNMAAYSATLAILVLGPSLISIVHNYGY 198
Fly 199 IFVMMRKIRSGEPIHDKEYATALAENLSNPSHMMSFALVF-AFWVSWL 245 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DopEcR | NP_001014559.1 | 7tm_classA_rhodopsin-like | 18..289 | CDD:410626 | 49/243 (20%) |
| TM helix 1 | 18..42 | CDD:410626 | 5/20 (25%) | ||
| TM helix 2 | 51..73 | CDD:410626 | 5/21 (24%) | ||
| TM helix 3 | 89..111 | CDD:410626 | 1/21 (5%) | ||
| TM helix 4 | 134..150 | CDD:410626 | 5/23 (22%) | ||
| TM helix 5 | 174..197 | CDD:410626 | 4/22 (18%) | ||
| TM helix 6 | 230..252 | CDD:410626 | 4/17 (24%) | ||
| TM helix 7 | 264..289 | CDD:410626 | |||
| LOC101735091 | XP_012824262.2 | 7tmA_OR | 25..294 | CDD:320092 | 49/243 (20%) |
| TM helix 1 | 27..51 | CDD:320092 | 5/22 (23%) | ||
| TM helix 2 | 60..82 | CDD:320092 | 5/21 (24%) | ||
| TM helix 3 | 98..120 | CDD:320092 | 1/23 (4%) | ||
| TM helix 4 | 143..159 | CDD:320092 | 2/15 (13%) | ||
| TM helix 5 | 196..219 | CDD:320092 | 4/22 (18%) | ||
| TM helix 6 | 238..260 | CDD:320092 | 5/28 (18%) | ||
| TM helix 7 | 269..294 | CDD:320092 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1099557at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||