DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11342 and AT5G51130

DIOPT Version :9

Sequence 1:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_568752.1 Gene:AT5G51130 / 835187 AraportID:AT5G51130 Length:318 Species:Arabidopsis thaliana


Alignment Length:258 Identity:69/258 - (26%)
Similarity:110/258 - (42%) Gaps:83/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YGNFFNYYQFSSAAERVKLLPDADIWLPALEDGETQKDKPYF----ILDVGCNCGVLTQLMHKYL 73
            :||:.|||.:     |:....|.|..|..|:       |.:|    .||:|||.|::|       
plant    64 FGNYRNYYGY-----RISNDTDEDPRLKVLK-------KEWFEGKDCLDIGCNSGIMT------- 109

  Fly    74 EERLHRSVK-----VLGVDIDPRLIQRA----------------SEENESPK-----------DV 106
               :|.:.|     :||||||...|:.|                ||:..|.:           .|
plant   110 ---IHIAKKFGCRSILGVDIDTSRIEDAHWHLRKFVRMQNSTKPSEKKSSSEGADGVHGSKEPSV 171

  Fly   107 SYACVDVLDDEA----------FESVKTYMEVNNLE--KFDAICCYSITMWIHLNHHDQGLRFFL 159
            |.:..:...|.|          |:. :.:::..||:  ::|.|.|.|:|.|:|||..|.||....
plant   172 SLSNGEAKADSAETKDLSQIVSFQK-ENFVQTRNLDDNRYDTILCLSVTKWVHLNWGDDGLITLF 235

  Fly   160 QKLSNLAE---LLVVEPQPWKCYQKAERRLKKAGEIFPLFLELKWRSDVDLQIQKYLEESLDR 219
            .|:..|.:   :.|:||||||.|:. .||:.:.       ..:.:|:.| |:..::.|..||:
plant   236 SKIWRLLQPGGIFVMEPQPWKSYEN-NRRVSET-------TAMNYRTIV-LRPDRFQEILLDK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 40/152 (26%)
AdoMet_MTases 134..238 CDD:302624 30/89 (34%)
AT5G51130NP_568752.1 Methyltransf_25 99..246 CDD:404528 41/157 (26%)
Bin3 210..318 CDD:399683 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2899
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.