DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11342 and LOC568375

DIOPT Version :9

Sequence 1:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_017208938.1 Gene:LOC568375 / 568375 -ID:- Length:254 Species:Danio rerio


Alignment Length:243 Identity:79/243 - (32%)
Similarity:131/243 - (53%) Gaps:12/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNDPGAVQYGNFFNYYQFSSAAERVKLLPDADIWLPALEDGETQKDKPYFILDVGCNCGVLTQLM 69
            :.:|||..||||.|||.|:....|:.|:|:|.:.......|:.::   ..:||||||.|.|:..:
Zfish    13 SENPGAAPYGNFINYYTFNPPENRLSLIPEALLQNIGFTSGDGER---VLMLDVGCNSGDLSVAL 74

  Fly    70 HKYL-------EERLHRSVKVLGVDIDPRLIQRASEENESPKDVSYACVDVLDD-EAFESVKTYM 126
            :|:|       .:...:.:.:||.|:|..||.||...|..|:::.:..:|:.|| |:...::.::
Zfish    75 YKHLLNKEACTSDSPRQELYMLGFDLDQDLILRAQTSNPFPQNIQFIPLDITDDTESRAVLQAFL 139

  Fly   127 EVNNLEKFDAICCYSITMWIHLNHHDQGLRFFLQKLSNLAELLVVEPQPWKCYQKAERRLKKAGE 191
            ......:|....|:::|||:||||.|......|.:|::.:|.|::|.||||||:.|.|||:|.|.
Zfish   140 GKFGCSRFHLSTCFAVTMWVHLNHGDAAFLSLLSRLASHSEYLLLEAQPWKCYRSAARRLRKLGR 204

  Fly   192 I-FPLFLELKWRSDVDLQIQKYLEESLDRRKIFKSAPTKWQRKICFYR 238
            . |..|..||.|.|:....:::||:......:.....|.|.|.:..:|
Zfish   205 SDFDHFKALKIRGDMAAHAREHLEKQCSMELVQCFGNTSWDRSLLLFR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 36/116 (31%)
AdoMet_MTases 134..238 CDD:302624 38/104 (37%)
LOC568375XP_017208938.1 AdoMet_MTases 152..252 CDD:302624 37/99 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589287
Domainoid 1 1.000 82 1.000 Domainoid score I8382
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12594
Inparanoid 1 1.050 148 1.000 Inparanoid score I4372
OMA 1 1.010 - - QHG45376
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 1 1.000 - - FOG0007133
OrthoInspector 1 1.000 - - oto40310
orthoMCL 1 0.900 - - OOG6_110142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4485
SonicParanoid 1 1.000 - - X5229
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.