DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11342 and MEPCE

DIOPT Version :9

Sequence 1:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_062552.2 Gene:MEPCE / 56257 HGNCID:20247 Length:689 Species:Homo sapiens


Alignment Length:233 Identity:62/233 - (26%)
Similarity:90/233 - (38%) Gaps:84/233 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYGNFFNYYQFSSAAERVKLLPDADIWLPALEDGETQKDKPYF-----ILDVGCNCGVLT-QLMH 70
            ||||:..||.:.:               |:.|||..:..||.:     :||:|||.|.|| .:..
Human   414 QYGNYCKYYGYRN---------------PSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLSIAC 463

  Fly    71 KYLEERLHRSVKVLGVDIDPRLIQRA--------SEENESPKDV-----------------SYAC 110
            |:...|:      :|:|||.|||..|        |||...|...                 ..:|
Human   464 KWGPSRM------VGLDIDSRLIHSARQNIRHYLSEELRLPPQTLEGDPGAEGEEGTTTVRKRSC 522

  Fly   111 ------------------VDVLDDEAFESVKTYMEVN-----------NLEKFDAICCYSITMWI 146
                              :|..|...|.:...::..|           ...::|.:.|.|:|.|:
Human   523 FPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWV 587

  Fly   147 HLNHHDQGL-RFFLQKLSNL--AELLVVEPQPWKCYQK 181
            |||..|:|| |.|.:...:|  ..:||:|||||..|.|
Human   588 HLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGK 625

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 40/164 (24%)
AdoMet_MTases 134..238 CDD:302624 23/51 (45%)
MEPCENP_062552.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..314
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..407
AdoMet_MTases 446..616 CDD:100107 43/175 (25%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000269|PubMed:30559425, ECO:0000269|Ref.26, ECO:0007744|PDB:5UNA, ECO:0007744|PDB:6DCB, ECO:0007744|PDB:6DCC 451..453 1/1 (100%)