DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11342 and mepcea

DIOPT Version :9

Sequence 1:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001122001.1 Gene:mepcea / 561384 ZFINID:ZDB-GENE-030131-3936 Length:701 Species:Danio rerio


Alignment Length:356 Identity:83/356 - (23%)
Similarity:114/356 - (32%) Gaps:162/356 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYGNFFNYYQF----SSAAERVKLL-PDADIWLPALEDGETQKDKPYFILDVGCNCGVLTQLMHK 71
            ||||:..||.:    .|...|:::: ||   |...       ||    :||:|||.|.||..:.|
Zfish   370 QYGNYNKYYGYRNPGMSEDPRIRVMNPD---WFRG-------KD----VLDLGCNTGHLTLFIAK 420

  Fly    72 YLEERLHRSVKVLGVDIDPRLI------------------QRASEEN-----------ESPKDVS 107
            .     .|...::|:|||..||                  .|.|.||           |..||.:
Zfish   421 N-----WRPASIVGLDIDGSLIHAARQNIRHYLSEVQVQHSRRSGENTKADRGEVSGEEKDKDKT 480

  Fly   108 YACVDVLD----DEAFESVKTYMEVNNLEK----------------------------------- 133
            ...:|...    ||..:.:...||||..||                                   
Zfish   481 SLVMDEKKAKHVDEVNKCMDEGMEVNQEEKREADRGEIGDGASVDLPDGKHSFPVSLRISRGPIA 545

  Fly   134 ------------------------------------------FDAICCYSITMWIHLNHHDQGL- 155
                                                      :|.|.|.|:|.|:|||..|.|| 
Zfish   546 GPPLPETNTHSLPPGDFPANVTFIKGNYVLESDVLLQTQREEYDVILCLSVTKWVHLNWGDAGLK 610

  Fly   156 RFFLQKLSNL--AELLVVEPQPWKCYQKAER------------RLKKAGEIFPLFLELKWRSDVD 206
            |||.:...:|  ..|.::|||||..|.|.::            |||.  :.|..||    .::|.
Zfish   611 RFFHRVYKHLRPGGLFILEPQPWSSYNKRKKLTEAICKNYHSIRLKP--DQFSSFL----TTEVG 669

  Fly   207 LQIQKYLEESLDRRKIFKSAPTKWQRKICFY 237
            ....:.:..|.:..|.|       ||.|..|
Zfish   670 FSSYELIGTSQNYSKGF-------QRPISLY 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 47/219 (21%)
AdoMet_MTases 134..238 CDD:302624 38/119 (32%)
mepceaNP_001122001.1 Methyltransf_25 404..>455 CDD:316196 16/55 (29%)
Bin3 588..695 CDD:311052 38/119 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2899
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.