DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11342 and SPBC2A9.10

DIOPT Version :9

Sequence 1:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_596220.1 Gene:SPBC2A9.10 / 2540331 PomBaseID:SPBC2A9.10 Length:268 Species:Schizosaccharomyces pombe


Alignment Length:223 Identity:57/223 - (25%)
Similarity:98/223 - (43%) Gaps:73/223 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYGNFFNYYQFSSAAE----RVKLLPDADIWLPALEDGETQKDKPYFILDVGCNCGVLTQLMHKY 72
            |:||:.:||.......    |:|.|||:..:..:             :||:|||.|.::..:   
pombe     5 QHGNYHSYYSMRGGTSIIDPRLKCLPDSLFYEAS-------------VLDIGCNNGTVSAQI--- 53

  Fly    73 LEERLHRSVKVLGVDIDPRLIQRASEENE----------SPKDVSYACVDVLDDE----AFESVK 123
              ..:..:..|||:|||..|||:|.:..|          :|.       .:::|:    ...|:|
pombe    54 --ASIFGASFVLGLDIDHVLIQKARKHLEFVSSRIGPVRNPG-------SIVEDQFNYYPISSIK 109

  Fly   124 TYMEV--------------NNLE-------------KFDAICCYSITMWIHLNHHDQGLRFFLQK 161
            .:..:              :|:|             ||..|...|::.|:|||:||:|:..|..|
pombe   110 KFSRIPVQLQPPLNKQNFPHNIEFETADFLRWESKRKFKIILALSVSKWVHLNNHDEGIIKFFGK 174

  Fly   162 LSNLAE---LLVVEPQPWKCYQKAERRL 186
            :|:|.|   :|::|||.|..|.||.:::
pombe   175 ISSLLETNGVLILEPQGWDSYLKAAKKI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 37/149 (25%)
AdoMet_MTases 134..238 CDD:302624 23/56 (41%)
SPBC2A9.10NP_596220.1 Methyltransf_18 36..189 CDD:289607 40/177 (23%)
Bin3 147..256 CDD:284317 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2899
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.