Sequence 1: | NP_647896.1 | Gene: | CG11342 / 38538 | FlyBaseID: | FBgn0035537 | Length: | 238 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017176362.1 | Gene: | Mepce / 231803 | MGIID: | 106477 | Length: | 710 | Species: | Mus musculus |
Alignment Length: | 265 | Identity: | 66/265 - (24%) |
---|---|---|---|
Similarity: | 102/265 - (38%) | Gaps: | 90/265 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 QYGNFFNYYQFSSAAERVKLLPDADIWLPALEDGETQKDKPYF-----ILDVGCNCGVLT-QLMH 70
Fly 71 KYLEERLHRSVKVLGVDIDPRLIQRA--------SEE---------------------------- 99
Fly 100 -------NESPKDVSYACVDVLDDEAFESVKTYMEVNNL-----------EKFDAICCYSITMWI 146
Fly 147 HLNHHDQGL-RFFLQKLSNL--AELLVVEPQPWKCYQKAERRLKKAGEIFPLFLELKWRSDVDLQ 208
Fly 209 IQKYL 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11342 | NP_647896.1 | Methyltransf_12 | 56..165 | CDD:285454 | 40/164 (24%) |
AdoMet_MTases | 134..238 | CDD:302624 | 28/83 (34%) | ||
Mepce | XP_017176362.1 | AdoMet_MTases | 423..593 | CDD:100107 | 43/175 (25%) |
Bin3 | 552..650 | CDD:369112 | 28/83 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2899 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |