DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11342 and Mepce

DIOPT Version :9

Sequence 1:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_017176362.1 Gene:Mepce / 231803 MGIID:106477 Length:710 Species:Mus musculus


Alignment Length:265 Identity:66/265 - (24%)
Similarity:102/265 - (38%) Gaps:90/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYGNFFNYYQFSSAAERVKLLPDADIWLPALEDGETQKDKPYF-----ILDVGCNCGVLT-QLMH 70
            ||||:..||.:.:               |:.||...:..||.:     :||:|||.|.|| .:..
Mouse   391 QYGNYCKYYGYRN---------------PSCEDVRLRVLKPEWFQGRDVLDLGCNVGHLTLSIAC 440

  Fly    71 KYLEERLHRSVKVLGVDIDPRLIQRA--------SEE---------------------------- 99
            |:...|:      :|:|||||||..|        |||                            
Mouse   441 KWGPARM------VGLDIDPRLIHSARQNIRHYLSEELRLQAQTSEGDPGTEGEEGTITVRKRSC 499

  Fly   100 -------NESPKDVSYACVDVLDDEAFESVKTYMEVNNL-----------EKFDAICCYSITMWI 146
                   :..|.......:|..|...|.:...::..|.:           .::|.:.|:|:|.|:
Mouse   500 FPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDELVDAQRPEYDVVLCFSLTKWV 564

  Fly   147 HLNHHDQGL-RFFLQKLSNL--AELLVVEPQPWKCYQKAERRLKKAGEIFPLFLELKWRSDVDLQ 208
            |||..|:|| |.|.:...:|  ..:||:|||||..|.|   |......|:..:..::.:.:   |
Mouse   565 HLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYCK---RKSLTETIYKNYFRIQLKPE---Q 623

  Fly   209 IQKYL 213
            ...||
Mouse   624 FSSYL 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 40/164 (24%)
AdoMet_MTases 134..238 CDD:302624 28/83 (34%)
MepceXP_017176362.1 AdoMet_MTases 423..593 CDD:100107 43/175 (25%)
Bin3 552..650 CDD:369112 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2899
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.