Sequence 1: | NP_647896.1 | Gene: | CG11342 / 38538 | FlyBaseID: | FBgn0035537 | Length: | 238 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001921729.2 | Gene: | mepceb / 100151157 | ZFINID: | ZDB-GENE-110411-13 | Length: | 629 | Species: | Danio rerio |
Alignment Length: | 234 | Identity: | 53/234 - (22%) |
---|---|---|---|
Similarity: | 83/234 - (35%) | Gaps: | 85/234 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 YGNFFNYYQFSSAAERVKLLPDADIWLPALEDGETQKDKPYFILDVGCNCGVLTQLMHKYLEERL 77
Fly 78 HRSVKVLGVDIDPRLIQRASEE------------------------------------------- 99
Fly 100 ----------------NESPKDVSYACVDVLDDEAFESVKTYMEVNNLEKFDAICCYSITMWIHL 148
Fly 149 NHHDQGL-RFFLQKLSNL--AELLVVEPQPWKCYQKAER 184 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11342 | NP_647896.1 | Methyltransf_12 | 56..165 | CDD:285454 | 37/168 (22%) |
AdoMet_MTases | 134..238 | CDD:302624 | 22/54 (41%) | ||
mepceb | XP_001921729.2 | Methyltransf_18 | 384..557 | CDD:289607 | 40/190 (21%) |
Bin3 | 515..622 | CDD:284317 | 22/54 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2899 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1185441at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |