DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11342 and mepceb

DIOPT Version :9

Sequence 1:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_001921729.2 Gene:mepceb / 100151157 ZFINID:ZDB-GENE-110411-13 Length:629 Species:Danio rerio


Alignment Length:234 Identity:53/234 - (22%)
Similarity:83/234 - (35%) Gaps:85/234 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YGNFFNYYQFSSAAERVKLLPDADIWLPALEDGETQKDKPYFILDVGCNCGVLTQLMHKYLEERL 77
            |..::.|...|..|:     |...::.|....|:.       :||||||.|.:|..:.|:..   
Zfish   358 YSRYYGYRTPSMTAD-----PRLALFNPEWFSGKK-------VLDVGCNTGHVTLAIAKHCS--- 407

  Fly    78 HRSVKVLGVDIDPRLIQRASEE------------------------------------------- 99
              ...:||:|||..|:|.|.:.                                           
Zfish   408 --PAHILGLDIDGALVQAARQNLRHFLSELQDRQQAGAGEGSEVTGLVPLMDLQLVLPRFPVSFM 470

  Fly   100 ----------------NESPKDVSYACVDVLDDEAFESVKTYMEVNNLEKFDAICCYSITMWIHL 148
                            .:.|.:|.:...|.:.|...|.|....|      :|.|.|.|:|.|:||
Zfish   471 RCRGPIAAPPIMHQSLGQFPSNVCFLKGDYVPDSDAEVVSQSAE------YDVILCLSLTKWVHL 529

  Fly   149 NHHDQGL-RFFLQKLSNL--AELLVVEPQPWKCYQKAER 184
            |:.|.|: |.|.:...:|  ..:|::|||||..|.:.:|
Zfish   530 NYGDAGIQRLFGRIYRHLLPGGVLILEPQPWSSYSRHKR 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 37/168 (22%)
AdoMet_MTases 134..238 CDD:302624 22/54 (41%)
mepcebXP_001921729.2 Methyltransf_18 384..557 CDD:289607 40/190 (21%)
Bin3 515..622 CDD:284317 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2899
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.