DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and MRP17

DIOPT Version :9

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_012923.3 Gene:MRP17 / 853867 SGDID:S000001486 Length:131 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:32/129 - (24%)
Similarity:60/129 - (46%) Gaps:16/129 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YELALVLR-------QLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHGVVHREG 61
            |||..::|       :|...||.|.|   .:.|:...|::|.:..:|.|.||..:.:....|...
Yeast     3 YELIGLVRITNSNAPKLEAKELSSTI---GKLIIQNRGVVRDIVPMGIRYLPKIMKKDQEKHFRA 64

  Fly    62 THFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEPEQ--KPCTLHEEMLPPAYRKDVQEII 123
            .||.:.||::....:::.....:|..:||..|.||:..:|  :..:||..:    .:|.:.|::
Yeast    65 YHFLMLFDSSAAVQSEILRTLKKDPRVIRSSIVKVDLDKQLDRASSLHRSL----GKKSILELV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 25/98 (26%)
MRP17NP_012923.3 bS6_mito 2..99 CDD:275386 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0360
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005647
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104065
Panther 1 1.100 - - LDO PTHR21011
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.860

Return to query results.
Submit another query.