DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and MRPS6

DIOPT Version :9

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_115865.1 Gene:MRPS6 / 64968 HGNCID:14051 Length:125 Species:Homo sapiens


Alignment Length:136 Identity:54/136 - (39%)
Similarity:78/136 - (57%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHGVVHREGTHFT 65
            ||.|||||:|:.:.|||..:.::||.|:::|:|.|:|.|||||.||||:::|.|...|..|.:|.
Human     1 MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFL 65

  Fly    66 IAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEEP---EQKPCTLHEEMLP-PAYRKDVQEIIAAA 126
            :.|......:..:.|...||||:||..|  |:.|   |.|.|   |.::| |...|      ..:
Human    66 VDFYAPTAAVESMVEHLSRDIDVIRGNI--VKHPLTQELKEC---EGIVPVPLAEK------LYS 119

  Fly   127 QKKQKK 132
            .||:||
Human   120 TKKRKK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 39/92 (42%)
MRPS6NP_115865.1 bS6_mito 3..96 CDD:275386 40/94 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7874
eggNOG 1 0.900 - - E1_COG0360
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52251
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005647
OrthoInspector 1 1.000 - - oto89436
orthoMCL 1 0.900 - - OOG6_104065
Panther 1 1.100 - - LDO PTHR21011
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3570
SonicParanoid 1 1.000 - - X5303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.