DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and mrp17

DIOPT Version :9

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_593428.2 Gene:mrp17 / 2542478 PomBaseID:SPAC343.08c Length:111 Species:Schizosaccharomyces pombe


Alignment Length:102 Identity:21/102 - (20%)
Similarity:48/102 - (47%) Gaps:7/102 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSYELALVLR------QLPRPEL-ISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHGVVH 58
            |..|||..:.|      :...|.| :::.:....:|||..|::..:|::|.:.|...:.:....:
pombe     1 MVMYELFCITRPAANATRTSSPTLAMNIAKNCGRAILDNKGVVVDVESMGLKELAKPIKKLNQSY 65

  Fly    59 REGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFK 95
            ..|..:::.|.:.||..::::.....:..::|..|.|
pombe    66 SFGHWWSMTFYSNPTVQSEIQRILRLEPSVLRYMIVK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 20/100 (20%)
mrp17NP_593428.2 bS6_mito 3..103 CDD:275386 20/100 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0360
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005647
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104065
Panther 1 1.100 - - LDO PTHR21011
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.