DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and mrps-6

DIOPT Version :9

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_491318.2 Gene:mrps-6 / 187843 WormBaseID:WBGene00020037 Length:162 Species:Caenorhabditis elegans


Alignment Length:166 Identity:40/166 - (24%)
Similarity:73/166 - (43%) Gaps:39/166 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSYELALVLRQLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHK--------------- 50
            ||.||::::.|.|.:.:|:..:.|...::||.|.:|.|:|:||.|.||:|               
 Worm     1 MPFYEVSMITRSLSKADLVKALTRAGNTLLDHGAVIEKVESLGHRDLPYKRLAKQTNEPVYASNF 65

  Fly    51 --VSEHGVVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEE-PEQK-PCTLHEEML 111
              ...|  :.||....|             |.....|:|.::..:.:|:. |..| .|.|.|.:.
 Worm    66 FLFKAH--MSREARQKT-------------KSILTHDLDTVQVDLIQVDTLPAPKVECNLEEILK 115

  Fly   112 PPAYRKDVQEIIAAAQKKQKKKFNYNSGLDYYPFQK 147
            .||.|:.|:::     ::.:|..::...:.|...:|
 Worm   116 SPAERQAVKDL-----RENQKMGHFTRQMIYKRTEK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 25/109 (23%)
mrps-6NP_491318.2 bS6_mito 3..98 CDD:275386 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166430
Domainoid 1 1.000 47 1.000 Domainoid score I8132
eggNOG 1 0.900 - - E1_COG0360
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4085
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473530at2759
OrthoFinder 1 1.000 - - FOG0005647
OrthoInspector 1 1.000 - - oto19780
orthoMCL 1 0.900 - - OOG6_104065
Panther 1 1.100 - - LDO PTHR21011
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3570
SonicParanoid 1 1.000 - - X5303
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.