DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS6 and Mrps6

DIOPT Version :9

Sequence 1:NP_001246623.1 Gene:mRpS6 / 38535 FlyBaseID:FBgn0035534 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_038944711.1 Gene:Mrps6 / 100360017 RGDID:2322928 Length:96 Species:Rattus norvegicus


Alignment Length:97 Identity:34/97 - (35%)
Similarity:49/97 - (50%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LDKGGIIRKLENLGSRALPHKVSEHGVVHREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIF 94
            :|:|.|:|.|||||.||||:::|.|...|..|.:|.:.|......:..:.|...||.|::|..| 
  Rat     1 MDRGAIVRNLENLGERALPYRISSHSQQHSRGGYFLVDFYAPTNAVESMLEHLARDTDVVRPNI- 64

  Fly    95 KVEEP---EQKPC------TLHEEMLPPAYRK 117
             |:.|   |.|.|      .|.|::.....||
  Rat    65 -VKHPLTQEVKECDGIVPVPLEEKLYSTKRRK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS6NP_001246623.1 bS6_mito 3..96 CDD:275386 25/65 (38%)
Mrps6XP_038944711.1 bS6_mito <1..67 CDD:275386 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7772
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5000
OMA 1 1.010 - - QHG52251
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005647
OrthoInspector 1 1.000 - - oto96561
orthoMCL 1 0.900 - - OOG6_104065
Panther 1 1.100 - - LDO PTHR21011
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5303
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.