DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cip4 and LSB1

DIOPT Version :9

Sequence 1:NP_001097501.1 Gene:Cip4 / 38534 FlyBaseID:FBgn0035533 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:26/94 - (27%)
Similarity:43/94 - (45%) Gaps:22/94 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 HTSLPGSGQGS--ANENAIGEDTYYETEVETLNPVGKCRALYPFEASSEGSIPMSEGEELQVIEI 631
            ::.||....|:  :.:||..|: |.|             |||.|||..:|.:.:..|:::||:|.
Yeast    35 NSKLPEKWDGNQRSPQNADTEE-YVE-------------ALYDFEAQQDGDLSLKTGDKIQVLEK 85

  Fly   632 DQGDGWTRVRRENNSNGWDEGFVPTSYIE 660
            ...| |.|.:..|..     |..|.:|::
Yeast    86 ISPD-WYRGKSNNKI-----GIFPANYVK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cip4NP_001097501.1 F-BAR_CIP4-like 69..319 CDD:153337
HR1_CIP4-like 412..488 CDD:212009
SH3_CIP4-like 603..661 CDD:212844 18/58 (31%)
LSB1NP_011652.1 SH3 55..108 CDD:214620 21/72 (29%)
PRK14971 <100..>156 CDD:237874 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2056
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.